KEGG   Cronobacter turicensis: CTU_22760Help
Entry
CTU_22760         CDS       T00999                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctu  Cronobacter turicensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CTU_22760 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_22760 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CTU_22760 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTU_22760 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CTU_22760 (adhA)
   00626 Naphthalene degradation
    CTU_22760 (adhA)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CTU_22760 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2387686..2388690)
Genome map
AA seq 334 aa AA seqDB search
MVKAFGQPLEIQEVLVPEVTPGKVLVKIAATGVCHTDLHAAEGDWPVKPNPPFIPGHEGV
GHVVAVGQGVTHIKEGDRVGVPWLYSACGHCEHCLSGWETLCHGQQNSGYSVNGTFAEYC
LADANYVGILPDNVEFTSIAPILCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHLAIQYA
NAMGLNVAAVDIDKDKLEFAKRLGAQVVANALEVDPGSYFHDTFGGAHGVLVTAVSPKAF
AQATTMMRRGGTMVLNGLPPGKFDLSIFDMVLDGTTVRGSIVGTRKDLQEALDFAGHNKV
AAEIAVEPLENINDIFARMRNGKITGRIVVDMSL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaagccttcgggcagccgctggagatccaggaagtgctggtgccggaagtgacg
ccgggtaaagtgctggtgaaaatcgccgcgaccggcgtctgccataccgatttacacgcg
gcggaaggcgactggccggtgaaaccgaacccgccgtttattccggggcacgaaggcgta
ggccacgtcgtggcggtcggtcagggggtgacgcacattaaagagggcgatcgcgtcggc
gtgccgtggctctattccgcctgcggccattgcgaacactgcttaagcggctgggaaacg
ctctgtcacggccagcaaaactccgggtattcggtgaacggcacctttgcggagtattgc
ctggcggatgccaattacgtcggcatcttgccggataatgttgaattcaccagcattgcg
ccaatcctctgcgcgggcgtcacggtctataaagggctgaaaatgaccgacaccaaaccg
ggcgactgggtggtgatttccggtattggcgggttagggcatctggctattcagtacgcc
aacgccatggggctgaacgtggcggcggtggatatcgacaaggataagctggagttcgcg
aaacgcctcggcgcgcaggtcgtcgccaacgcgctggaagtcgatccgggcagctatttc
catgacaccttcggcggcgcgcacggcgtgctggtgacggcggtctcgccaaaagcgttc
gcgcaggccacaacaatgatgcgccgtggcggcaccatggtgttaaacggcctgccgccg
ggcaaattcgatctctctatcttcgatatggtgctggacggcacgacggtgcgcggctcg
attgtgggcacgcgtaaagacttgcaggaggcgctcgatttcgccgggcataacaaagtg
gcggcggaaattgcggtcgagccgctggagaatatcaacgatattttcgctcgtatgcgt
aacgggaaaatcaccggccgcatcgtggttgatatgtcgctgtaa

DBGET integrated database retrieval system