KEGG   Cronobacter turicensis: CTU_23160Help
Entry
CTU_23160         CDS       T00999                                 

Gene name
ycjM
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ctu  Cronobacter turicensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTU_23160 (ycjM)
Enzymes [BR:ctu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CTU_23160 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2425026..2426741)
Genome map
AA seq 571 aa AA seqDB search
MEKITTAAINFGVIKNLITRIYGDAFNQANFSTLEKHIVQARNEITSPRKKGWDETDVVL
ITYADQFSAPGEKRLATFQRFFETWLKPRFSHIHLLPFFPWSSDDGFSVVDYHRVDPQCG
DWRDIARLNQHARLMFDFVCNHISAQSEWFADYLAQKPGYEDFFIDVDPRTDLSAVTRPR
ALPLLTPFTMQNGRVCHLWTTFSEDQIDLNFANPVVLLAMVDVLLHYLREGAQYVRLDAV
GFMWKTPGTSCIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNIAYLGNGFDEAQ
MVYQFPLPPLVLHAIHTQNARTLCQWAQGLSEARVGDTTWFNFLASHDGIGLNPLRGILP
EADILRLVDALQAEGARVNWKNNPDGTRSPYEINVTYMDALSARHDSDATRLARFLLAHA
LLLTFPGVPAIYIQSILGARNDEEGVARLGYNRAINRQKYTEAEITAALQTEGNLRHDTW
KQLGDLITRRRQHAAFHPDSAFTARCINDEVLEIIRTAENGVSVAALFNLSDKLQVISYD
APGCCDLISGTTINTASLTLAPWQAMWLSKA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataacaaccgccgcgataaatttcggcgttattaaaaatctgattacgcgg
atttatggcgatgcatttaatcaggcgaatttcagcacgcttgaaaaacatattgtgcaa
gcacgcaatgaaattacctcgccccgtaaaaaaggatgggatgaaacggatgtcgtatta
attacctatgccgatcagttcagcgcgccgggtgaaaaacgcctcgcgacctttcagcgt
ttttttgaaacctggttaaaaccgcgcttttcacatattcatcttttgccattctttccc
tggtcatccgacgacgggttttccgtggtggactatcaccgcgtcgacccgcagtgcggc
gactggcgcgatatcgccaggcttaatcagcacgcgcggttgatgttcgattttgtctgc
aaccatatttccgcgcaaagcgaatggtttgcggattatctggcgcaaaaaccgggttat
gaagatttctttatcgatgtcgatccccgtaccgatttatccgccgtcacccggccgcgg
gcgctgccgttattaacgccgtttaccatgcagaacggacgcgtgtgccatctgtggacc
acctttagcgaagaccagattgaccttaatttcgctaatccggtcgtgctgctggcaatg
gtggatgtcctgctgcattacctgcgcgaaggagcgcaatatgtccgcctcgatgccgtc
gggtttatgtggaaaacacccggaacgagctgcatccatctggaaaaaacacacctgtta
gtgaagctgtttcgcgctattgccgatgtggtcgccccgggcaccgtgatcatcaccgaa
accaacgtgccgcataaagacaatatcgcgtacctcggcaacggtttcgatgaagcgcag
atggtctatcagttcccgctgccgccgctggtgctccacgctattcatactcagaatgcc
cgcacgctctgccagtgggcgcaggggttaagcgaggcgcgcgtgggcgataccacctgg
tttaatttcctggcctcgcatgacggcatcgggcttaacccgctgcgcgggatcctcccc
gaagctgatattttacggctggtggacgctctccaggccgaaggcgcgcgcgttaactgg
aagaataacccggacggcacccgcagcccgtatgaaatcaacgtcacctatatggatgcg
ctcagcgcgcgacatgacagcgacgcgacgcgccttgcgcgtttcctgctggcccacgcg
ctgttattaactttccccggcgtcccggcgatttatattcaaagtattctcggcgcgcgt
aatgatgaagagggcgttgcgcgtctcggatataaccgcgccattaaccggcagaaatat
accgaggcggaaataacggcggcgttacagaccgaagggaatttacgtcacgacacctgg
aaacagcttggcgatttaattacgcgtcgccgtcagcacgccgcgtttcatcccgacagc
gcctttaccgcccgctgtatcaatgatgaagtgctggagattatccgcaccgcggaaaat
ggcgtgtcggtcgccgcattatttaatctcagcgataaattgcaagttatttcttatgac
gcgcctggctgttgtgacttaatttctggaacgacaataaataccgcctcgctcactctc
gccccctggcaagcaatgtggcttagtaaagcctga

DBGET integrated database retrieval system