KEGG   Cronobacter turicensis: CTU_23590Help
Entry
CTU_23590         CDS       T00999                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ctu  Cronobacter turicensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTU_23590 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTU_23590 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTU_23590 (trpB)
Enzymes [BR:ctu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTU_23590 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2471462..2472655
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQSDAEFQAQFTDLLKNYAGRPTALT
KCQNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMKLMGAEVIPVYSGSATLKDACNEALRDWSGS
YDRAHYMLGTAAGPHPFPTIVREFQRMIGEETRVQIMEKEGRLPDAVIACVGGGSNAIGM
FADFINETSVGLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDDGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRAEYVSITDNEALEAFKTLCRQEGIIPALESSHALAHALK
MMRADPEKEQLLVVNLSGRGDKDIFTVHDIFKARGEM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactgttaaatccctattttggcgaattcggcggcatgtatgtgccgcagatc
ctcatgcccgccctgcgtcagctggaagaggcgttcgtcagcgcccagagcgacgcggaa
ttccaggcgcagtttaccgatctcttaaaaaactatgccgggcgcccgacggcgctgacc
aaatgtcagaacctcactgaaggcacccgcaccacgctctatctcaagcgtgaagatctg
ctgcacggcggcgcgcataaaaccaaccaggtattgggacaggcgctgcttgccaaacgc
atgggcaaaactgaaatcatcgccgaaaccggcgcaggccagcacggcgtggcgtcagcg
ctggcgagcgctctgcttggcctgaagtgccgcatctatatgggggcgaaagatgtcgag
cgccagtcgccaaacgtgttccgcatgaagctgatgggcgcggaagtcattccggtgtac
agcggctccgcgaccctcaaagatgcgtgcaacgaggcgctgcgcgactggtccggcagc
tatgaccgcgcgcactatatgctcggcaccgccgcaggcccgcacccgttcccgactatc
gtgcgtgaattccagcgcatgatcggcgaagagacgcgcgtgcaaatcatggaaaaagaa
ggccgcctgccggatgccgtgatcgcctgcgtcggcggcggctccaacgccatcggcatg
tttgcggatttcattaacgaaacgagcgtcggcctgattggcgtcgagcctgccggtcac
ggtattgaaaccggcgaacacggcgcgccgctcaaacacggacgcgtgggaatttacttc
ggtatgaaagcgccgatgatgcagacggacgacggccagattgaagagtcttactctatc
tccgccggtctcgatttcccgtctgtcgggccgcaacatgcgtacctgaacagcatcgga
cgcgcggaatatgtctcgattaccgataacgaagcgctggaagcctttaaaacgctctgc
cgtcaggaggggatcatcccggcgctggaatcgtctcacgccctcgcccatgcgctgaaa
atgatgcgcgccgatcctgaaaaagagcagttgctggtcgttaacctgtccgggcgcggc
gataaagatatcttcaccgttcacgatattttcaaagcacgaggggaaatgtaa

DBGET integrated database retrieval system