KEGG   Cronobacter turicensis: CTU_23600Help
Entry
CTU_23600         CDS       T00999                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctu  Cronobacter turicensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTU_23600 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTU_23600 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTU_23600 (trpA)
Enzymes [BR:ctu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTU_23600 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2472655..2473464
Genome map
AA seq 269 aa AA seqDB search
MERYEQLFDRLAARKEGAFVPFVTLGDPSPEQSLQIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFASGTTPDQCFEMLAAVRQKYPDLPIGLLMYANLVFSRGVDEFYARCAA
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLIEKLTEYHAAPPLQGFGISEPAQVKAAIEAGAAGAISGSAIVKI
IENNLNDRAAMLDALKTFVRQLKAASLPA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatgagcagctgtttgaccgcctggcagcccgtaaggaaggcgcgtttgtt
ccctttgtgacgctcggcgatccgtcgcctgagcagtcgttgcagattatcgacgcgctg
gtggaaggcggcgccgacgcgctggagcttggtattcccttctccgatccgctggcggac
gggccgactatccagagcgcgacgctgcgcgccttcgcctctggcaccacgccggatcag
tgctttgaaatgctggccgcggtacgccagaaatacccggacttgcccatcgggctttta
atgtatgccaacctggtgttcagccgcggcgtggatgagttctatgcccgctgcgccgcg
gtgggtgtggattcggtactggtggccgacgtgccggtggaagaatctgccccgttccgc
caggcggcgatgcgccacaacgtcgcgccgattttcatctgcccgccgaacgctgatgac
gatctgctgcgccagatagcgtcttacggccgcggctacacctatttgctttcgcgcgcc
ggggtgacgggcgcggaaaaccgcgccgcgctgccgctaaaccatctcatagagaagctt
accgaatatcacgcagctcccccgttgcagggctttgggatctctgagcctgcgcaggtc
aaagccgccattgaagcgggtgccgctggcgcgatctccggctcggcgatcgtgaagatc
attgagaacaatctaaacgatcgcgcggcgatgcttgacgcgctgaaaacgtttgtccgc
cagctgaaagcggccagtttgcccgcataa

DBGET integrated database retrieval system