KEGG   Cronobacter turicensis: CTU_23890Help
Entry
CTU_23890         CDS       T00999                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00040  Pentose and glucuronate interconversions
ctu00052  Galactose metabolism
ctu00500  Starch and sucrose metabolism
ctu00520  Amino sugar and nucleotide sugar metabolism
ctu01100  Metabolic pathways
ctu01130  Biosynthesis of antibiotics
Module
ctu_M00362  Nucleotide sugar biosynthesis, prokaryotes
ctu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CTU_23890 (galU)
   00052 Galactose metabolism
    CTU_23890 (galU)
   00500 Starch and sucrose metabolism
    CTU_23890 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CTU_23890 (galU)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CTU_23890 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBA31379
UniProt: C9XTS4
Position
complement(2499532..2500464)
Genome map
AA seq 310 aa AA seqDB search
MNSPGEYSMAAINSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAA
GITEIVLVTHSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLA
KGLGHAVMCAHPVVGNEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGRSQIMVEPV
ADVTAYGVVDCQGAQLQAGDSVPMVGIVEKPKADVAPSNLAVVGRYVLGADIWPLLAKTP
PGAGDEIQLTDSIAMLMDKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGEEFKT
WLNDTVGDKK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagtccaggagaatattcaatggctgccattaattcgaaagtgaaaaaagcagta
atcccggttgcgggattaggaaccaggatgttgccggccacgaaggcgattccaaaagag
atgctgccgctggtggataaaccgttaattcagtatgtcgttaatgagtgtattgccgct
ggcattactgagattgttctggtcactcactcctcaaaaaactccatcgaaaaccacttc
gataccagctttgaacttgaagcgatgctggaaaaacgcgttaagcgccagctgctggaa
gaagtacagtccatctgcccgccgcacgtgactatcatgcaggtgcgtcagggtctcgcg
aaaggcctgggtcacgcggtaatgtgcgcgcatccggtggtcggcaacgagccggtggcc
gtgatcctgccggacgttatcctcgatgagtttgaatccgatctctcccaggacaacctg
gcggaaatgattaagcgtttcgacgaaacaggccgcagccaaatcatggttgagccggtg
gctgacgtgaccgcgtacggcgtggtggattgccagggcgcgcagctgcaggcaggcgac
agcgtgccgatggttggcatcgttgagaaaccgaaagccgatgtggcgccgtctaacctc
gcggttgtcggccgttacgtgcttggcgctgacatctggcctctgctggcgaaaacccct
ccgggagcgggtgatgagatccagctgaccgactccatcgcgatgctgatggataaagaa
accgtcgaggcctaccacatgaaaggcaaaagccacgactgcggcaacaaactgggttac
atgcaggccttcgtggaatacggaattcgccacaatacgctgggtgaagagttcaaaacc
tggcttaacgacaccgtcggcgacaagaagtaa

DBGET integrated database retrieval system