KEGG   Cronobacter turicensis: CTU_25440Help
Entry
CTU_25440         CDS       T00999                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctu  Cronobacter turicensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2664585..2665196)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIVLEKQPPLVLLEAGGVGYEIHMPMTCFYELPETGKEAVVFTHFVVREDAHLL
FGFNNKQERTLFRELIKVNGVGPKLALAILSGMSAQQFVNAVEREEPAALVKLPGIGKKT
AERLVVEMKDRFKGLHGDLFTPAADLVLTSPASPAVDDAEAEAVAALVSLGYKPQEASRM
VSKVAQPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcgtactggaaaaacagcccccgctggtgttactggag
gcgggcggcgtcggttatgaaatccatatgccgatgacctgcttctatgaattgccggaa
accggcaaagaagcggtggtcttcacccattttgtggtgcgtgaagacgcgcatttactg
ttcggctttaataacaaacaagagcgcacgctgtttcgcgaactgatcaaagtgaacggc
gtcgggccgaaactggcgctggctattctctccggcatgtccgcccagcagttcgttaac
gcggttgagcgcgaagagccagccgcgctggtgaaactgccgggcatcggcaagaaaacc
gccgaacgtctggtggtggagatgaaagaccgcttcaagggtctgcatggcgatcttttc
acgccagcggcggatctggtactgacgtcgcctgccagccctgcggtggatgatgccgag
gcggaagccgttgccgcgctggtgtcgctgggttataaacctcaggaagccagtcgtatg
gtcagtaaagtcgcccagccggatgcgagcagcgaaacgctgattcgcgaagcgctgcgc
gcggcattgtga

DBGET integrated database retrieval system