KEGG   Cronobacter turicensis: CTU_26220Help
Entry
CTU_26220         CDS       T00999                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:3.5.99.7 4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ctu  Cronobacter turicensis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CTU_26220 (dcyD)
Enzymes [BR:ctu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     CTU_26220 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2736736..2737716)
Genome map
AA seq 326 aa AA seqDB search
MHNLTRFARLELIGAPTPLDFLPRLSDYLGREIFIKRDDAMPVAMGGNKLRKLEFLAAQA
LREGADTLVTAGAIQSNHVRQTAAVAARLGLHCVALLENPIATREENYLTNGNRLLLDLF
NVQVEMCDALDAPDQQLDELAVRLEAQGFRPYVIPVGGSNVLGALGYVESTLEIVQQCEG
IVRPSSVVVASGSAGTHAGLAVGLEQGMPDAELIGVTVSRSVAMQKPKVVALQQGVAEAL
ELEARADIVLWDDYFAPGYGMPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGISQN
RFKDNGPILFIHTGGAPALFAYHPHV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcataatcttacccgctttgcgcgtcttgagcttatcggcgcgcccacgccgctggat
ttcctgccgcgcctgtccgactacctgggccgtgaaatttttatcaagcgcgatgacgcg
atgccggtggcaatgggtggcaataagctgcgcaagctggagtttctcgcggctcaggcg
ctgcgcgaaggcgccgacacgctggtgaccgcgggcgctatccagtctaaccatgtgcgc
cagacggcggcggtcgccgcgcgcctcggtttacattgcgtggcgctactggaaaacccg
atcgccacgcgtgaagagaactatctgacgaacggcaaccggctgttgctggatctcttt
aacgtgcaggttgaaatgtgcgacgcgctggacgcgccggaccagcagcttgacgaactg
gcggtgcgtctggaggcacagggctttcggccttatgtgatcccggtcggcggctcgaat
gtgctgggcgcgctcggctatgtcgaaagcacgcttgaaattgtgcagcagtgcgaaggc
atcgtgcgtccgtcttccgtggtggtagcttccggcagcgccggtacgcacgcggggctg
gccgtcgggctggagcaggggatgcccgacgccgagcttatcggcgtaacggtgtcgcga
agcgttgcgatgcagaagccgaaagtggtggcgttgcagcagggcgtcgccgaggcgctg
gagctggaagcgcgggccgatattgtgctgtgggacgattacttcgcgccaggctacggc
atgccgaatgacgaaggcatggaagcggtgaagctgctggcgcgccttgaaggcattctg
ctggatccggtttataccggcaaagcgatggccgggctgattgacggcatctcgcagaac
cgtttcaaagataacggaccgattctctttattcacaccggcggcgctccggcgctgttc
gcgtaccatccgcatgtctga

DBGET integrated database retrieval system