KEGG   Cronobacter turicensis: CTU_27390Help
Entry
CTU_27390         CDS       T00999                                 

Gene name
galF
Definition
GalU regulator GalF (EC:2.7.7.9 4.1.2.13)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctu  Cronobacter turicensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CTU_27390 (galF)
   00052 Galactose metabolism
    CTU_27390 (galF)
   00500 Starch and sucrose metabolism
    CTU_27390 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    CTU_27390 (galF)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CTU_27390 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2847972..2848898)
Genome map
AA seq 308 aa AA seqDB search
MIHQPFEVGEKMINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGI
KEIVLVTHSSKNAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLG
LGHSILCARPIIGDNPFVVVLPDVIIDAASADPLRYNLAAMIARFQENGRSQVLAKRMAG
DLSEYSVITTQDALDTEGKISRIVDFIEKPDQPQTLNSDLMAVGRYVLSADVWEELAKTE
PGAWGRIQLTDAIARLNENQPVEAMLMTGESYDCGKKMGYMKAFVNYGLRNLKEGQKFRN
QIQKLLSK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ataattcatcaaccttttgaggtgggagagaaaatgattaatttaaaagcagtcatcccg
gtagccgggctcggcatgcatatgctgccagccactaaggctattccgaaggaaatgcta
cctatcgtcgataagccaatgattcagtatattgtcgacgaaatcgtagcggcgggaatc
aaggaaattgtgctggttacccactcctccaagaacgcggttgagaaccacttcgacacc
tcttacgaactcgaagcgctgcttgaacagcgtgtgaagcgtcagctgcttgcagaagtg
cagtctatctgcccgccgggcgtgaccatcatgaacgtgcgtcaggcgcagccgctgggc
cttgggcactccattctgtgtgcccgcccgattattggcgacaacccgtttgtggtcgta
ctgccggatgttattattgacgccgcttctgctgacccgctgcgttataacctggccgct
atgattgcgcgcttccaggaaaatggccgcagccaggtactggccaagcgtatggcaggc
gatctctctgaatactccgtgatcaccacccaggatgcgctggataccgaaggtaaaatc
agccgtatcgtcgacttcatcgagaagccagaccagccgcagacgctgaattctgatctg
atggcggtcgggcgttatgtgctgtccgcggatgtctgggaagaactcgcgaaaaccgag
ccgggcgcctggggacgtatccagttgactgacgccatcgcgcgccttaacgagaatcag
cctgttgaagcgatgctgatgaccggcgaaagctacgattgcggcaaaaaaatgggttat
atgaaggcgttcgtcaactacggcctgcgtaacctgaaagaagggcagaagttccgtaac
cagattcagaagctgctttctaaataa

DBGET integrated database retrieval system