KEGG   Cronobacter turicensis: CTU_28310Help
Entry
CTU_28310         CDS       T00999                                 

Gene name
fruA
Definition
PTS system fructose-specific transporter subunits IIBC (EC:2.7.1.69)
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
ctu  Cronobacter turicensis
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CTU_28310 (fruA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    CTU_28310 (fruA)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     CTU_28310 (fruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2951066..2952760)
Genome map
AA seq 564 aa AA seqDB search
MKTLLIIEPGYGQARAYMAKTLLGAAAQKAQLELTDNPNDAELAIVIGSAVPTDASLNGK
KVYLGDINRAVAHPELFLSEAKSHAKAYTAPAAAPAASVNASGPKRIVAVTACPTGVAHT
FMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAQADLVIVAADIEVDLAKFAGKP
MYRTSTGLALKKTAQEFDKAVAEAKPYQPAGAGAAATDKKEQGGAGPYRHLLTGVSYMLP
MVVAGGLLIALSFVFGIEAFKQEGTLAAALMKIGGGSAFALMVPVLAGYIAFSIADRPGL
TPGLIGGMLAVSTGSGFIGGIIAGFLAGYVAKAISGKVKLPQSMEALKPILIIPLFSSLI
VGLAMIYVIGTPVAKILAGLTAWLQSMGTANAVLLGAILGAMMCTDMGGPVNKAAYAFGV
GLLSSQVYAPMAAIMAAGMVPPLAMGIATLVARRKFDKGQQEGGKAALVLGLCFISEGAI
PFAARDPMRVIPCCIAGGALTGAISMAIGAKLMAPHGGLFVLLIPGAITPVLGYLLAIVA
GSLLAGLVYAFLKRPESEMAAKAA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctgctgattatcgagcccgggtatggacaggcccgcgcttatatggcgaaa
acgctgcttggcgccgccgcgcaaaaagcacagctggaattaaccgataacccgaacgat
gcggagctggcgattgttatcggcagtgccgtaccgacggacgcatccctgaacggcaaa
aaggtttacctcggcgatattaatcgtgccgtggcgcacccggagctgttcttaagcgaa
gcgaaatctcacgcgaaggcttataccgcgcctgccgccgctcctgcggcaagcgtaaac
gccagcggcccgaaacgcatcgtggcggtcacggcctgcccgaccggcgtggcgcacacc
tttatggcagcggaagcaattgaaaccgaagccaaaaaacgcggctggtgggtgaaagtg
gaaacgcgcggctctgtcggcgcgggtaatgcgattacgccggaagaagtggcgcaggcg
gatctggtcattgtggcggcggatatcgaagtggatctggcgaagtttgccggtaagccg
atgtatcgcacctcgactggtctggcgctgaagaaaaccgcgcaggagttcgacaaagcg
gtagcggaagcgaaaccgtaccagcctgcaggcgcaggcgctgcggcgacggataaaaaa
gagcagggcggcgcgggtccgtaccgtcatctgctgaccggcgtgtcctatatgctgccg
atggtggtagcgggcggtctgctgattgcgctctcgtttgtgttcggtatcgaagcgttt
aaacaggaagggacgctggcggctgcgctgatgaaaatcggcggcggctctgcattcgcc
ctgatggtgccggtactggcaggttatatcgcgttctctatcgccgaccgtccgggcctc
acgccgggtcttatcggcggtatgcttgcggtcagcaccggttctggctttatcggcggt
atcatcgcgggtttcctggccggttacgtggcgaaagccatcagcggtaaagtaaaactg
ccgcagagcatggaagcgctgaagccgatcctgattattccgctgttttccagcctgatt
gtgggtctggcgatgatttacgtgatcggtacgccggttgccaaaatcctggcgggcctg
accgcgtggctgcagagcatgggtacggcgaacgccgtcctgctgggtgccatcctcggc
gcgatgatgtgtaccgatatgggcggtccggtgaacaaagcggcgtatgcctttggcgtg
gggctgctgagttctcaggtgtatgcgccgatggcggcgattatggcggccggtatggtt
ccgccgctggcgatgggtatcgccaccctggtggcgcgtcgtaaattcgacaaaggccag
caggaagggggcaaagcggcgctggtgctgggcctgtgctttatctccgaaggcgctatc
ccgttcgcggcgcgtgatccgatgcgtgtgatcccgtgctgtatcgcgggcggcgcgctg
accggcgctatctccatggcgattggcgcgaaactgatggcgccgcacggcggtctgttc
gtcctgctgatcccgggcgccattaccccggtgctgggctacctgctcgccatcgtggca
ggttcgctgctggcgggtctggtttacgccttcctgaagcgtcctgaaagcgaaatggcg
gcgaaagcggcctga

DBGET integrated database retrieval system