KEGG   Cronobacter turicensis: CTU_33680Help
Entry
CTU_33680         CDS       T00999                                 

Gene name
recD
Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctu  Cronobacter turicensis
Pathway
ctu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTU_33680 (recD)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTU_33680 (recD)
DNA repair and recombination proteins [BR:ctu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTU_33680 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 PhoH AAA_16 AAA_28 UvrD_C CbiA T2SSE AAA TrwB_AAD_bind SRP54 MukB ATPase Bcl-2 AAA_29 DUF87 NTPase_1 Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: CBA33349
UniProt: C9XZJ2
Position
complement(3517988..3519823)
Genome map
AA seq 611 aa AA seqDB search
MKMHQLIQQAVVQKLLRPLDAQFAMMVASDEEPAVMLAAALVSRDAGEGHVCLPVSRLCV
AHCFAGRHDEMAQRLFEAAGNPDDWRSLLLNSPAVSEDDAPTPLKLIGDRLYLNRMWRHE
MAVASFFRECNHRIELEEARLSSVLAALFGPPGDEVDWQKVAAAVALTRRIAVISGGPGT
GKTTTVAKLLAAMVQLCDEKLPRIRLAAPTGKAAARLTESLGAALRRLPLSDAQKNALPE
EASTLHRLLGAQPGSQRLRYHEGNPLHLDVLVVDEASMIDLPMMARLIAALPEHARVIFL
GDRDQLASVEAGAVLGDICHYVNHGFTAERAAELGRITGCNIGGGEPHPAGALRDCLCLL
QKSYRFGSDSGIGQLAFAVNRSDHRAASATFSRGFEDIACKTLAGNDDYAQMIDETLAGY
ERFLTLVRERAEPEAILAAFSEFQMLCALREGPFGVAGLNERVEHALAQRRLIRRTPLSR
WYEGRPVMISRNDSALGLFNGDIGVALDRGDGLRVWFPMPGGKLKPVVPSRLPDNDTAWA
MTVHKSQGSEFDHAALLLPGQFAPVVTRELVYTAITRARRRLSLYADERVLEMAIATRTE
RRSGLMACFEQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcatcaactgatccagcaggccgtcgtgcaaaagctcctgcgcccgctggat
gcccagtttgcgatgatggtggcaagcgatgaagaacccgcggtgatgctcgccgccgcg
ctggtcagccgcgacgccggggaagggcatgtctgcctgccggtctcccggctgtgtgtg
gcgcactgcttcgccgggcgtcacgatgaaatggcgcagaggctgtttgaggccgcgggc
aacccggacgactggcgctctctgctgctgaattcgcccgcggtcagcgaggacgatgcg
ccgacgccgctgaagcttatcggcgatcgtctgtacctgaaccgtatgtggcgtcatgag
atggcggtcgcgtcgtttttccgtgagtgcaaccaccgtattgaactggaagaggcgcgc
ctgagcagcgtgctggcggcgctttttggcccgccaggcgatgaagtggactggcagaaa
gtcgcggcggcggtcgcgctgacccgacgcatcgcggtgatttctggcgggccgggaacc
gggaaaaccactacggtggcgaaactactggcggccatggttcaactctgcgatgaaaag
ctgccgcgtattcgtctggcggcgcctaccggtaaagcggcggcgcgcctgacggaatcg
cttggcgccgcgctgcgccgtttgccgctgagcgacgcgcagaaaaacgcgctgccggaa
gaagccagcacgctgcaccgcctgctgggcgcacagccgggcagtcagcggctgcgctat
catgagggcaatccgctgcatctggatgtcctggtggtggatgaagcctcgatgatagac
ctgccgatgatggcgcggcttatcgcggcgctgccggaacacgcgcgggtgattttttta
ggcgatcgcgatcagctggcctccgtagaggcgggcgcagtgcttggcgatatctgccac
tacgtgaaccacggtttcactgcggaacgcgccgccgagcttggccgcatcacggggtgt
aacattggcggcggcgagccgcatccggcaggggcgctgcgcgactgcctgtgcctgctg
cagaaaagctatcgctttggcagcgattccggcatcgggcagctcgcgtttgccgtcaac
cgcagcgatcatcgcgccgccagcgcgacgttcagtcgcggctttgaggatatcgcctgc
aaaacgctggcaggcaacgacgactacgcgcagatgatcgacgaaaccctggcgggctat
gagcggtttttaacgctggtgcgcgagcgcgccgagccggaggccattcttgcggccttc
agcgaatttcagatgctctgtgcgctgcgcgaagggccattcggcgtcgccgggcttaac
gagcgcgtggagcatgcgctggcgcagcggcgactgatccgccgcacgccgctatcgcgc
tggtatgaaggacgtccggtgatgatttcacgcaacgacagcgcgctggggctgtttaac
ggcgatatcggcgtggcgctggatcggggcgacggcctgcgcgtctggttcccgatgccc
ggcggtaagttaaagcccgtggtgccgagccgtttgccggataacgataccgcgtgggcg
atgacggtgcataagtcgcagggctcggaattcgaccatgcggcgctgctcctgccgggg
cagtttgcgccggtagtgacgcgtgagctggtctatacggcgattacccgcgcgcggcgg
cggttgtcgctgtatgcggatgaacgggtgctggagatggctatcgcgacccgaacggaa
cggcgcagcggcctgatggcctgttttgagcagtaa

DBGET integrated database retrieval system