KEGG   Cronobacter turicensis: CTU_37380Help
Entry
CTU_37380         CDS       T00999                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00010  Glycolysis / Gluconeogenesis
ctu00620  Pyruvate metabolism
ctu00640  Propanoate metabolism
ctu00680  Methane metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_37380 (acs)
   00620 Pyruvate metabolism
    CTU_37380 (acs)
   00640 Propanoate metabolism
    CTU_37380 (acs)
  Energy metabolism
   00680 Methane metabolism
    CTU_37380 (acs)
Enzymes [BR:ctu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CTU_37380 (acs)
Lipid biosynthesis proteins [BR:ctu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CTU_37380 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBA34055
UniProt: C9Y1C7
Position
3888605..3890563
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPATIAERCLITPEQYDAKYQQSVHDPDAFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLNERGDQTAIIWEGDDASQSKHISYRELHRDVCRF
ANTLTSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNA
RLVITADEGVRAGRTIPLKKNVDDALKNPGVTSVEHVVVFKRTGGNTEWHEGRDLWWNEL
VEKASAHHQPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFLYAFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPSANRMAQVVDKHKVNILYTAPTA
IRALMAEGDKAIDGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVIDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPQQGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSIKGQAIYAYVTLNHGEEPSAELYSEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatccataaacaccctattcccgcgactatcgcggaacgctgcctgattacg
ccggaacaatatgatgcgaaatatcagcagtccgtgcatgaccctgacgcgttctggggc
gagcagggcaaaatccttgactggatcacgccctaccagaaggtaaaaaacacctctttc
gcacccggcaatgtctcgattaaatggtatgaagacggcacgctgaacctcgcggcgaac
tgccttgaccgacacctcaacgagcgcggcgatcagaccgccatcatctgggaaggcgac
gacgcctcccaaagcaaacacattagttaccgcgaacttcaccgcgacgtctgccgcttc
gcgaacaccctgacctctctcggcattaagaaaggcgacgtggtcgctatctatatgccg
atggtgccggaagccgccgtcgcgatgcttgcctgcgcccgtatcggcgcggtgcactcg
gttattttcggcggcttttcgccggaggccgtcgccgggcgcattatcgactccaacgcg
cgtctcgttatcaccgccgatgaaggcgtgcgcgccggccgtacgattccgcttaagaaa
aacgtcgatgacgcgctgaaaaacccgggcgtcaccagcgtggaacatgtggtggtgttt
aaacgcaccggcgggaataccgaatggcatgaagggcgcgatctctggtggaacgagctg
gttgaaaaagccagcgcgcatcatcaaccggtggagatgaacgccgaagatccgctgttt
atcctctatacctccggctcgaccggtaaaccgaaaggcgtgctgcacaccaccggcggt
tatctggtctatgcggccaccacgttcctgtacgcctttgactaccatccgggcgatatc
tactggtgcaccgcggatgtgggctgggtgaccggccacagctatctgctgtacggaccg
ctcgcctgcggcgccaccacgctgatgtttgaaggcgtgccgaactggccctccgccaac
cgtatggcgcaggtggtggacaagcacaaggtcaatattctctataccgcgccgacggcc
attcgcgcgctgatggcggaaggcgacaaggctatcgacgggactgaccgttcgtcgctg
cgcattcttggttccgtcggcgagccgatcaacccggaggcgtgggagtggtactggaag
aaaatcggcaatgaaaaatgcccggtcatcgacacctggtggcagaccgaaaccggcggc
ttcatgattacgccgctgcccggcgcgaccgagctgaaagccggctccgccacgcgtccg
ttcttcggcgtgcagcctgcgctggtggataacgaaggcaatccgcaacagggcgcgaca
gagggcaacctggtcattaccgattcctggccgggccaggcgcgcacgctgtttggcgat
cacgaacgtttcgagcagacctatttctcaacgtttaaaaacatgtacttcagcggcgac
ggcgcgcgtcgtgacgaagacggttactactggataaccgggcgcgtggacgacgtgctg
aacgtatcggggcaccgtctcggcaccgctgaaattgagtccgcgctggtctcacatccg
aaaatcgccgaagccgcggtggtgggcattccacacagcattaaaggccaggcgatctat
gcttacgtgacgctgaaccacggcgaggagccgtcggcggaactctacagcgaagtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggatgtgctgcactggaccgac
tcgctgccgaaaacccgctccggcaaaatcatgcgtcgtattttgcgcaaaatcgcggcg
ggcgataccagcaacctcggcgatacctcaacgcttgccgatccgggcgtggtggaaaaa
ctgctcgaagagaagcagtccatcgcgatgccgtcgtaa

DBGET integrated database retrieval system