KEGG   Cronobacter turicensis: CTU_39260Help
Entry
CTU_39260         CDS       T00999                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctu  Cronobacter turicensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTU_39260 (malQ)
Enzymes [BR:ctu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CTU_39260 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4071783..4074044)
Genome map
AA seq 753 aa AA seqDB search
MLKPRSRWMCSTATRKPGPVRLFSIPRAAACSALTAPSGIISNVSGRQNAKGAAMESKRL
DSSALAAGISPNYINAHGKPQAIGAETKRRLLEAMNPEAAPKAADKSPLPPVKVVTKSRR
MQLTPQGRGDYHWLLTSETGEQFSGNARGGEALTLPAKLEEGYHTLTLTRDDNRWHCRLI
VAPKRCYEPQALREGKKLWGACVQLYTLRSQNNWGIGDFGDLKAMLNEVGPRGGAFIGLN
PIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRRSDEAQTWWKRDATQQALKAAR
ESQWVDYSTVTMLKLTALRMAWTRFSTRGPDDDDVVAFRDFVARSGESLYWQAAFDAIHA
WQAQEDPMRWGWPAWPKAYQNTSSPEVQAFCKKRADEVDFYLWLQWLAYEQFARCWETSQ
SYDMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHVM
QARAYEPFIELLRANMTHCGALRIDHVMSLLRLWWIPYGETADNGAYVQYPVDDLLAILA
LESQRHRCMVIGEDLGTVPAEIVGKLRDSGVYSYKVLYFENEGGSRFRAPKRWTSQAMAV
ATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLEGLYADRERAKQGLLESLHQHGCLPKR
AGHHAARMKMGATLNRALQRYIADSNSALLGLQPEDWLDMAQPVNVPGTSYQYQNWRRKL
TVDLETMFADDTVNRLIKDLDKRRRAASAVKRK
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcccagaagcaggtggatgtgctctaccgcgaccaggaagcctggacccgtg
cggctattctcaataccgcgcgctgcggcatgttcagctctgaccgctccatccgggatt
atcagcaacgtatctggcaggcaaaacgctaaaggagccgccatggaaagcaaacgcctt
gactcctccgcccttgcggcggggattagccctaactacatcaatgcgcacggcaaaccg
caggcgattggcgctgagaccaaacggcgtttgctggaagcgatgaaccctgaggccgcg
ccgaaagcggccgataaatcgccgctgccgccggtgaaagtggtgacgaaaagccgccgt
atgcagttaacgccgcaaggccgcggtgactaccactggctgctgaccagcgaaaccggc
gagcagtttagcggcaacgcgcgcggcggcgaggcgctgacgctgcctgcgaagctggaa
gaggggtatcacacgctgacgctcacgcgtgacgataatcgctggcactgtcggcttatc
gtcgcgccgaagcgttgctatgagccgcaggcgctgcgtgagggtaaaaaactctggggc
gcgtgcgtacagctttacacgctgcgctcgcaaaacaactggggcatcggggatttcggc
gatctgaaagcgatgctgaatgaagtgggcccgcgcggcggcgcgtttatcggcttaaac
ccgatccatgcgctctacccggcgaacccggaaagcgcgagcccgtacagcccgtcgtcc
cgccgctggcttaacgttatctatattgacgttaacgccgtggaagattttcggcgtagc
gatgaggcgcagacctggtggaagcgcgacgccacgcagcaggcgctgaaagcggcccgc
gagtcgcagtgggtcgattactcgaccgtgaccatgctgaagctcacggcgctgcggatg
gcctggacgcgcttctccacgcgcggtccggatgatgacgatgtggtggcgtttcgcgat
ttcgtggcccgctcgggcgaaagcctttactggcaggcggcgttcgacgcgattcacgcc
tggcaggcgcaggaagatccgatgcgctggggctggccggcctggccgaaagcgtatcag
aacaccagcagcccggaagtgcaggcgttttgcaaaaaacgggcggatgaggtcgatttt
tatctctggctgcaatggctcgcgtatgagcagtttgcccgctgctgggagaccagccag
tcatacgacatgccgatcgggctgtatcgcgatctggcggttggcgtggcggaaggcggc
gcggaaacctggtgcgaccgcgagctgtactgcctgaaggcgtcggtcggcgcgccgccg
gatattctggggccgcttggccagaactggggcctgccgccgatggatcctcacgtgatg
caggcgcgcgcctacgagccgtttatcgaacttctgcgcgccaatatgacccactgcggc
gcgctgcgcatcgaccatgtaatgtcgctgctgcgtctgtggtggatcccgtacggcgaa
acagcggataacggcgcttacgtgcagtatccggtcgacgatctgctggcgatcctcgcg
ctcgaaagccagcgccaccgctgtatggtgatcggcgaagatctcggtacggttccggcg
gagatcgtcggcaagctgcgcgacagcggcgtctactcgtacaaagtcctctactttgaa
aacgaagggggcagccgcttccgcgcgccgaaacgctggacgtcgcaggcgatggcggtc
gcgaccactcacgatctgccgacgctgcgcggctactgggaaagcggcgatttaaccctc
ggtaaaacgctggggctctatcccgatgaagaggtgttagaagggctgtacgccgatcgc
gagcgggccaaacagggactgctggagagcttgcatcagcatggctgcctgccgaaacgc
gcaggacaccacgccgcgcgcatgaaaatgggcgccacgctgaaccgcgcgctccagcgc
tatatcgccgacagcaatagcgcgctgctcggacttcagccggaagactggctggatatg
gcgcagccggtgaacgtgccaggcaccagctatcagtaccaaaactggcgtcgcaagctc
accgtcgatctggaaaccatgtttgccgacgacaccgttaaccggctgatcaaagacctc
gataaacgtcgccgcgccgcatcggcggtaaagcgtaaataa

DBGET integrated database retrieval system