KEGG   Cronobacter turicensis: CTU_40320Help
Entry
CTU_40320         CDS       T00999                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ctu  Cronobacter turicensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTU_40320 (bcsZ)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CTU_40320 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4189922..4191037)
Genome map
AA seq 371 aa AA seqDB search
MKNLCRWLTAGLLLATVSAHAACSWPDWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILLWTENNLAEGSLKNTLPAWLWGMKGPDDWAVLDTNSASDADLW
IAWSLLEAGRLWKEQRYSDTGKALLDRIAKEEVVNVPTLGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPEGFSPDWVSFEAKKGWVLKPVAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATTKAGLPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADDYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgtgcagatggcttacggcggggctgctactggcgacggtgtcagcccac
gccgcctgtagctggcccgactgggaccgctttaaaggcggctacatcagcgaagaaggg
cgcgtgattgacccgagcgatccgcgcaaaatcacgacgtccgaagggcagagctatgcg
ctgttcttcgccctcgcggccaatgaccgcgaggcgttcgacaacattctgctgtggacc
gaaaacaacctcgccgaaggatcgctgaaaaacacgctgcctgcctggctgtgggggatg
aaagggccggacgactgggcggtgctcgataccaactccgcctcagacgccgatctgtgg
atagcctggagcctgctggaggccgggcgtttatggaaagagcagcgttacagcgacacc
ggtaaagcgctgctggaccgcatcgccaaagaagaagtggtgaatgtgccgacgcttggc
gacatgctgctgccgggcaaagtcagcttcgccgaaccgacgctctggcgctttaacccg
agctatatgccgccgcagctggcgcgctatttcacccgttacggcaagccctggacgacc
atccgcgacaccaacctgcgtctgctgctggaaaccgcgccggaaggtttttcgccggac
tgggtcagctttgaggcgaagaaaggctgggtgctcaagcctgtggcgccgcaaaaaccg
ctgattggcagctacgatgcgatccgcgtttatctgtgggtcggcatgatgaacccggcg
gatgaacagcaggcgccgctgctcaaaaaacttagcccgatggaaaccgccaccaccaaa
gcgggcctgccgccggaaaaagtgcgcgttatcgacggcaaaacccagggcaacgggccg
gtgggcttctccgccgcgctgcttccctttctgcaaaaccgcgatatccaggcgctgcag
cgccagcgggtggcggacgactatccgcagcaggacgcctactttagctatgtgttaacc
ctgtttggccagggatgggatgaacaccgttttcgtttcaccgtcgacggtgagctgcaa
cccgcctggggagagtcatgcacaagttcgcgttaa

DBGET integrated database retrieval system