KEGG   Cronobacter turicensis: CTU_41100Help
Entry
CTU_41100         CDS       T00999                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctu  Cronobacter turicensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTU_41100 (pfkA)
   01230 Biosynthesis of amino acids
    CTU_41100 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_41100 (pfkA)
   00030 Pentose phosphate pathway
    CTU_41100 (pfkA)
   00051 Fructose and mannose metabolism
    CTU_41100 (pfkA)
   00052 Galactose metabolism
    CTU_41100 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CTU_41100 (pfkA)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTU_41100 (pfkA)
Protein phosphatases and associated proteins [BR:ctu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTU_41100 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4271039..4272073)
Genome map
AA seq 344 aa AA seqDB search
MTCRTCAGGFRRKYSFCILRSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVF
GVYDGYLGLYEDRMIQLDRYSVSDMINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLD
ALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALHTVVEAIDRLRD
TSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEVEFNREDLVSEIKAGIAKGKKH
AIVAITEHICDINELAKYIETETKRETRATVLGHIQRGGSPVPYDRILASRMGAYAIELL
LQGYGGRCVGIQNEKMVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atcacctgtcgcacttgcgcaggcggtttccggcgaaagtattccttttgcattctacgt
tcagaggtagtcatgattaagaaaatcggtgtgttgacgagtggcggtgatgcgccaggc
atgaacgccgccatccgcggtgtagtccgtgcggcgttgacagaaggtctggaagtgttc
ggcgtttacgacggctatcttggcctgtatgaagaccgcatgatccagctcgaccgctac
agcgtttccgacatgatcaaccgcggcggcaccttcctgggttccgcgcgtttcccggaa
ttccgcgaagaacatatccgcgccgtggctatcgagaacatgaagaaacgcggccttgat
gcgctggtggttatcggcggcgacggctcctacatgggcgccaaacgcctgaccgaaatg
ggcttcccgtgcatcggtctgccgggcaccatcgataacgacgtcgcgggcaccgattac
accatcggttatttcaccgcgctgcacactgtggttgaggcgatcgaccgtctgcgtgac
acctcctcttcgcaccagcgtatttccatcgtcgaagtgatgggccgttactgcggcgac
ttgaccctggcggcagccatcgcgggcggttgcgaatttatcgttctgccggaagttgaa
tttaaccgcgaagatctggtctctgaaatcaaagcgggcatcgcgaaaggcaaaaaacac
gctatcgttgcgatcaccgagcacatctgcgacatcaatgagctggcgaaatacatcgaa
accgaaaccaaacgcgaaacccgcgccaccgttctcggccacatccagcgcggcggctcg
ccggtgccttatgaccgcatcctggcctcccgcatgggcgcttacgccattgaactgctg
ctgcagggctacggcggccgctgcgtcggcattcagaacgaaaaaatggtgcatcacgac
atcatcgacgctatcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcg
aaaaagctctactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system