KEGG   Cronobacter turicensis: CTU_42020Help
Entry
CTU_42020         CDS       T00999                                 

Gene name
rbsK
Definition
(GenBank) Ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CTU_42020 (rbsK)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CTU_42020 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: CBA34526
UniProt: C9Y3G0
Position
complement(4371919..4372848)
Genome map
AA seq 309 aa AA seqDB search
MKSAGHLVVLGSINADHILNLEAFPAPGETVTGSQYQVAFGGKGANQAVAAGRSGAEIAF
IACVGEDDIGERIRQQLSRDNIDVSPVSAVAGESTGVALIFVNGEGENVIGIHAGANAAL
TPARVDDQRENIANARALLMQLESPVESVIAAARIAHEHQTTVILNPAPARALSDELLAL
VDIITPNETEAEKLTGVKVSDDDSAAQAAAVLHQKGIETVIITLGSRGVWLSINGEGQRV
PGFSVKAVDTIAAGDTFNGALMTALLEGTPMLKAIRFAHAAAAIAVTRPGAQPSVPWRDE
IDAFLQAQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgctggccatctcgtcgttctcggcagtatcaatgccgatcatatccttaac
cttgaagccttccccgcgccgggcgagaccgtgaccggcagccagtaccaggtggcgttc
ggcggtaaaggcgccaaccaggccgtcgcggccgggcgcagcggcgcggagatcgcgttt
atcgcctgtgtgggcgaggatgatatcggcgagcgcattcgccagcagctttcacgcgac
aacattgatgtctcgcctgtcagcgccgttgcgggagaatcgaccggcgtagcgctgatt
ttcgtcaatggcgaaggtgaaaacgtcatcggtattcatgctggcgcgaacgcggcatta
acgcccgcgcgtgttgacgatcagcgggagaacatcgccaacgcccgcgcgctgctgatg
cagctggagtcgccggtggaaagcgttatcgccgccgcgcgcatcgcgcatgaacatcaa
actaccgttattcttaacccggcgcctgcccgcgcgctttctgacgagctgctggcgctg
gtggatatcattacccctaatgaaaccgaagccgaaaaactcaccggcgtgaaggtgtcg
gatgacgacagcgcggcgcaggctgcggctgtgctgcaccagaaaggcattgaaacggtc
attattacgctcggtagccgcggcgtatggctgagcatcaacggcgaggggcaacgcgtg
cccggctttagcgtgaaagccgtcgataccatcgccgcaggcgataccttcaacggcgcg
ctgatgacggcgctgctggaaggcacgccgatgcttaaggctattcgcttcgcccatgct
gccgcggctatcgccgtgacccgtcctggcgcgcagccttccgttccgtggcgcgacgag
attgacgccttcttacaagcgcaggggtaa

DBGET integrated database retrieval system