KEGG   Cronobacter turicensis: Ctu_1p00660Help
Entry
Ctu_1p00660       CDS       T00999                                 

Gene name
casB
Definition
Phospho-cellobiase (EC:3.2.1.21 3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ctu  Cronobacter turicensis
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCTU1:52911..54302
Genome map
AA seq 463 aa AA seqDB search
MNTFPDGFLWGGAVAANQVEGAYLTDGKGLSTSDVQPRGILGPVVEREPGDRGIKDVAID
FYHRYPNDIALFAEMGFSCLRVSIGWTRIFPNGDEHEPNEAGLAFYDKLFDELAAHDITP
LVTLSHYEMPWGLVKQYGGWGNRETIGFFERYARTVFTRYQSKVKLWLTFNEINMSLHAP
MTGVGLPENSTQAQIYQAIHHQLVASALAVKACHEIIPDAKIGNMLLGGLMYPLTCKPDD
VFAALQENRTWQFFGDIQSRGAYPGYMLRYFRDNGISLDITNEDRVALRSTVDFISFSYY
MTGCVTTDEALNQQARGNILNMVPNPHLQSSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDRVEADGAINDDYRINYLNDHLVQVREAIEDGVDVLGYTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGSGTLARTRKKSFYWYKDVITSNGASLR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttcccggacggctttctgtggggcggcgcggttgccgcaaaccaggtggaa
ggcgcttatcttacggatggcaaagggctttccacctctgacgtgcagccccggggcatc
ctgggcccggtggttgagcgcgagcctggcgaccgcggcattaaagatgtggcgatcgat
ttttaccatcgctacccgaacgatatcgcgctgtttgccgaaatgggcttcagctgcctg
cgtgtttccatcggctggacacgtatcttcccgaacggcgacgagcacgagcccaatgaa
gcgggcctggcgttttacgataaactctttgacgagctggcggcgcatgacattacgccg
ctggtgacgttgtcacattatgagatgccctgggggctggttaaacagtacggcggctgg
ggaaatcgcgagacgatcggtttcttcgaacgttacgcgcgtaccgtgtttacccgctat
cagagcaaggttaaattgtggctgacctttaacgaaattaatatgtcgctgcatgcgccg
atgaccggcgtcggcctgccggaaaatagcacgcaggcgcagatttatcaggctatccac
catcaactggtggcaagcgcgctggcggtgaaggcgtgccacgagataattccggacgcg
aaaatcggcaatatgctgcttggcggcctgatgtatccgctcacctgcaagccggacgat
gtcttcgcggcactgcaggagaaccgcacctggcagttcttcggcgatatccagagccgc
ggcgcctaccccggctatatgctgcgttattttcgcgacaacggtatctcgctcgatatc
actaatgaagaccgcgtggcgctgcgctcgacggtcgatttcatctccttcagctactac
atgaccggctgcgtgacgaccgacgaggcgctgaaccagcaggcgcgcggcaacatcctg
aatatggtgccgaacccgcatctgcaaagctctgagtggggctggcaaattgaccctgtc
gggctgcgcacgctgctgaatgtgctctgggatcgctatcagaaaccgctgtttatcgtc
gaaaacggtcttggcgcgaaagaccgcgtggaggctgacggcgccattaatgacgactac
cgcatcaattacctgaacgatcatctggtgcaggtgcgggaggcgattgaggacggcgtg
gacgttttaggctatacgagctgggggccgattgatctggtgagcgcctcgaaagccgag
ctgtcgaaacgttacggcttcatttatgttgaccgccatgacgatggcagcggcacccta
gcccgtacgcgtaagaaaagcttttactggtataaagacgtgattaccagcaatggcgcc
tcgctgcgctga

DBGET integrated database retrieval system