KEGG   Cronobacter turicensis: Ctu_1p01030Help
Entry
Ctu_1p01030       CDS       T00999                                 

Definition
hypothetical protein
Organism
ctu  Cronobacter turicensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCTU1:complement(97425..98636)
Genome map
AA seq 403 aa AA seqDB search
MDASSHAVHARRTGQSLWPLALCAGLLGIGQNGLLVVLPQLVQMTGLSLSVWAGLLMFGS
MLFLPGSPWWGRQTEVRGCKFVVAAALGGYLLSFAVMALVVWGMARGVVGVSLGLAGLII
SRALYGLTVSGMVPAAQTWAMQRAGMEHRLAALASISSGLSCGRLIGPPLAAAALSVHPQ
MPLWLMALAPFIALLLVARQHNDPPLAPVARQSTRLRADMLPFLALALLLAAAVSLMQLG
LSPHLRPLFHGDLRAVSHHVALLLSLAAASTLLAQFLVVRPQRLQPRALLMAAAALMATG
LLLMILPGLVTFYAGIAITSFGAAMATPGYQVLLNDRLTTGKGAGVIATSHTLGYGVSAL
LVPVISLWFGEQMLIAAAFITAALFLLLSIGVWRRAAPQEPTV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcttctcacgccgtacacgcccgccgcacaggacaatcgctctggccgctg
gcgctgtgcgcgggtctgctcgggatcgggcagaacggtttgctcgtggtattgccgcaa
ctggtacagatgacggggctgtcgctctccgtctgggccggactgctgatgttcggttcg
atgctatttctgcccggatcgccctggtggggacggcagacggaagtgcgcggctgtaaa
tttgtggtggcggcggcgctcggcggttatctgctgagtttcgccgtgatggcgctggtg
gtctggggaatggcgcgcggcgtggtcggcgtgtccctggggctcgccgggctgattatc
tcgcgtgcgctctacggcctgacggtctccggcatggtgcctgccgcccagacgtgggcc
atgcagcgggcgggcatggagcaccggctcgcggcgcttgcctccatcagttccggcctg
agctgcgggcgtcttatcggcccgccgctggcggccgccgcgttaagcgttcacccgcaa
atgccgctctggctgatggcgctcgcgccctttatcgcgctgctgctggtggcgcgccag
cataacgatccgccgcttgcgcccgtggcgcgccagtcgacgcgcctgcgtgcggatatg
ctgcccttccttgcgctcgcgctgctgctggccgccgcggtcagcctgatgcagctcggc
ctgtcgccgcatctgcgcccgctgtttcatggcgatctccgcgccgtcagccatcacgtg
gcgctgctgctaagcctggcggcggcgagtacgctgctggcgcagttcctggtggtgcgc
ccacagcgccttcagccgcgcgcgctgctgatggcggcggcggcgctgatggcaactggt
ctgctgctgatgatcctgccggggctggtcaccttttacgccggtatcgcgataacctct
ttcggcgccgcgatggcgacgcctggctatcaggtgttgcttaacgaccggcttaccacc
ggcaaaggcgcgggcgttatcgccaccagccatacgctcgggtatggcgtaagcgccctg
ctggtgccggtgatttctctctggttcggcgagcagatgcttatcgctgccgcctttatc
accgccgcgctgtttttactgttaagcatcggcgtctggcgccgcgccgcgccgcaggag
cccaccgtatga

DBGET integrated database retrieval system