KEGG   Chlamydia trachomatis G/9301: CTG9301_00450Help
Entry
CTG9301_00450     CDS       T01906                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTG9301_00450
Enzymes [BR:ctv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CTG9301_00450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100052..101635)
Genome map
AA seq 527 aa AA seqDB search
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLHTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREHL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHVVGLFRFWVWDESGCGRFEPHDPKNYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcattatcccaatcccgacgtatcatccagcaatcttccattcgaaagatttgg
aatcagatagatacttctcctaagcatggcgtatgtgtaccgttattttctctccatact
caagaaagttgtgggataggtgaatttcttgacctgattcctatgatcgattggtgtatc
tcgtgtggttttcaaatccttcaaattcttccgattaacgatacagggtcctgttcgagt
ccttacaatagcatttcttcgatagcactcaatcctcttcacctttctatctctgcgctc
ccctataaagaagaagtgccagctgcggaaacacgcatacgagaaatgcagcaactctct
caacttcctcaagtacattatgaaaaagttcgctctatgaagagagatttttttcaagag
tactaccgcgtgtgtaaacagaaaaaactcactgatcatcctgatttttatgccttctgt
gaacaggaaaaatattggttacatccctacgctctctttcgctctatccgagaacatttg
gataaccttcctattaatcattggccaaccacctacacagatctctcccagattaccgag
catgaacgtacttttgcggaagatatacaatttcactcttatctacagtatttgtgcttc
caacagatgacacaagtgcgggagcatgccaattgcaaaagctgtctcatcaaaggggat
atccctattctaatcagtaaagatagctgcgatgtctggttttataggcattacttttcc
tcttcagaatctgtaggtgctcctcctgacctgtataatgcggaaggtcagaactggcat
ctccccatttataatatgaaaactttgcaacaagataactacctctggtggaaggagcgc
ttacgttatgcggagaatttttactctttataccgtcttgatcatgtcgtcggtctcttt
cgattttgggtatgggatgagtctggatgcggacgctttgaacctcatgatccgaaaaac
tatctagctcaagggcaagatatcttatctcacctcttgaccagttcatctatgctacct
ataggagaagatctgggaacgatcccttccgatgtgaaacgtatgctcgagtcttttgcc
gtatgcggcactagaattcctcgttgggaacgaaactgggaagggaatggagcctatacc
cctttcgatcaatacgaccctctatccgtcacaagcctctctactcatgattcctctaca
ttagcctcatggtggaaagaatctcctcaggaatccaaactatttgctcagtttttagga
ctcccctattcttccaccctatctcttcacaatcataccgaaatcctgaaactctctcac
aaaacctcttctatttttcgcatcaatcttattaatgactatctggctctgttcccggat
ttgatatcaaaaactcctcgctacgaaagaatcaatctgccaggaactatttcaaaaaat
aattgggtgtatcgagttaagccttctattgaagatttatcctctcattctaagctaaat
tctttacttgaggctctattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system