KEGG   Chlamydia trachomatis G/9301: CTG9301_00880Help
Entry
CTG9301_00880     CDS       T01906                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctv01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ctv00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ctv00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194578..195339
Genome map
AA seq 253 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPYQAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccattttttgaagat
cttttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggagcgg
atgtctttaatacaagaatacgcaagaggctttctgtattatatcccatatcaagctacg
agagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatctt
ccaattgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattat
tcagatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggta
gagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system