KEGG   Chlamydia trachomatis G/9301: CTG9301_01680Help
Entry
CTG9301_01680     CDS       T01906                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ctv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctv00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ctv00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369945..370769
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLSLCPDVNGLLVGGASLSSENFLSIIQQVDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaaaacgcttactgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaggctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactctagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcactttccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaagtcgatatcccataa

DBGET integrated database retrieval system