KEGG   Chlamydia trachomatis G/9301: CTG9301_02070Help
Entry
CTG9301_02070     CDS       T01906                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTG9301_02070
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTG9301_02070
  Amino acid metabolism
   00310 Lysine degradation
    CTG9301_02070
Enzymes [BR:ctv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTG9301_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459047..460213)
Genome map
AA seq 388 aa AA seqDB search
MFEFRFPKIGETASGGIVVRWLKQVGDPVQKDEPLIEVSTDKIATELAPSQAGILEECLV
QEGEEVFPGDILARLLETAAANTPVKSPVENPVREENHSVDREQKWFSPAVLGFAQREGL
DLQELQKISGTGEGGRITRKDVEHYLSDKREPRDPICSKEENRIPLSPLRRAIASSLRQS
SEEVPHASLVVDVDVTDLMNLISAERERFTAAHGVKLTITSFIIQCLAKSLEQFPLLNGS
LDGDTIVLKKAINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKVLADLSSRARSNKLDSS
ETKGGSVTVTNFGVTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMMCVTLT
FDHRILDGIYGGEFLTALKNRLESVTMS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtttcgatttccaaaaataggggagaccgcatctggaggtattgttgtccga
tggttgaaacaggtcggagatcctgttcaaaaagatgagccattgattgaggtctcaaca
gataagatagctacagagttagctccttctcaagctggcattttggaggagtgcctggtt
caggaaggggaagaggttttccctggagatattctagcgcgtttgctagaaactgctgca
gcgaatactcctgtaaaaagccctgtggagaatcctgttagagaagagaatcattctgta
gatagagagcagaaatggttctcgcccgcagtattaggatttgcccaaagagaagggtta
gatcttcaagaattacaaaagatctcggggacaggagaggggggacggattactcgtaag
gatgtagaacactatctttccgacaagagagaacctagggatccgatctgttctaaagag
gaaaatagaattcctttgtcacctttacgtcgggctatcgcttcttctttacgacagtct
tcagaagaggtgccgcatgcttctctggttgttgatgtagatgttacagatttaatgaat
ctcatctctgcggagcgagagagatttactgctgctcatggagtgaaactcacgatcacc
agcttcattatacagtgcttagctaagtctttagagcagttcccactgcttaatggttct
ttagacggggatacgattgtcctcaagaaggctataaatgtaggagttgctgtaaatttg
aataaagaaggagtagttgttcctgttattcataattgtcaggataggggtcttgtaagt
attgctaaggttcttgcggatctttcttcaagggcgcgatctaataaattagattcctca
gaaacgaaagggggaagcgtcactgtaaccaactttggtgtgactggagctcttattggc
atgccgataattcgttatccggaagtagcgattttggggatcggaacaattcaaaaacga
gtggttgtacgtgatgatgactcgttagccattaggaaaatgatgtgtgtcactttaact
ttcgaccatcgaatattggatggaatttacggtggagagtttttaacagctttgaaaaat
cgcttagagtctgttacgatgagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system