KEGG   Chlamydia trachomatis G/9301: CTG9301_04110Help
Entry
CTG9301_04110     CDS       T01906                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CTG9301_04110
Enzymes [BR:ctv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CTG9301_04110
Transfer RNA biogenesis [BR:ctv03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CTG9301_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907919..908947)
Genome map
AA seq 342 aa AA seqDB search
MFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPADYAIQYYFYQKLT
SLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSPESSHSSLFWLTD
PIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSENNSFKIYSAAKGEGLTICNPTHS
FPFSLHEDFQPTCKFCEASLSARNHQHLTTHILSKHLPWNPQPIRADSQCKYAWVADNTV
DFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLYLDRHPLILASAN
EQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcctcaatgactgccaaaaagctgcggaaacagttgtcatgcaggctatg
ctgtcactgatgcgctatcgaaaagctcataaatttattcccttttggaaaaagcctgac
cagacatacgttactcccgctgattacgctatccaatattatttttaccaaaaactgaca
tctttatttccgcatatcccgctggtcggagaagaaactctcaatcctgccacggatcac
cctaggatccctcaaatcctacaatttgcgcagcagctcgatcccaaagtctcctgtcaa
gatttgtatcaggccctctctccggaaagctcccactcttcactattttggttaacggac
cctatcgacggtacttcgggattcatcaaacaacgttgtttcgccatcgctctttctcta
ttttacgaacatactcctgttctctccgttatcgcttgcccttcttctgaaaataactct
ttcaaaatctattcggcagccaaaggcgaaggacttacgatttgtaatcctacccattcc
ttccccttctccctgcacgaagatttccaacctacctgtaaattctgtgaagcctcctta
tcagctagaaaccatcaacatttaactacacatattctcagtaaacatctcccttggaat
cctcagcctatccgagcagatagtcaatgcaaatacgcttgggttgcagataatacggta
gacttcttcattcgcatcccgtattcccctccacgagcccactacagagaccatgctccc
ggtgtgtttcttatagaagaagctggaggcctcgttacagatatatcggggaatcctctc
cctttttctaatccaaatttatatctagatagacatcctttgattcttgcttctgctaac
gagcaaatgcatagcacgattttagagactctatacaaactacgtcaccaagctactcaa
aacatgctcccccttgccactcatatctctgctactaagcataaacagctaagcgctctt
caactatag

DBGET integrated database retrieval system