KEGG   Chlamydia trachomatis G/9301: CTG9301_04375Help
Entry
CTG9301_04375     CDS       T01906                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctv01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ctv00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ctv00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965140..966300
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLTAYQLPIPPYHVATSVPEVETAIQAEQWKAGVVKAQVHAGGRGKNGGV
VIAHSPEDLLAAADKLLHMQFSSNQTAGLSLPINKVLISPLVEIASEYYLAIVIDRKHRC
PVIMLSKAGGVDIEEVAEKQPDQLLKMTLPSSGKIYGYQLRRIAKFMEWDQPIADQGNRI
IRQLLQCFYEKDASLLEINPLVLTKDGSLVILDAKMTIDDNALYRHPQLADCYDPSQENI
RDVLAKQLGLSYIALDGTIGCLVNGAGLAMSTLDILKLYGGSAANFLDVGGSASEKQIQE
AISLVLSDKSVRVLFIHIFGGIMDCAVVASGLVSAMQGQKETIPTVIRLEGTNVDKGKDM
IINAGIPCEFVTSMSEGAELAVQLSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtatcaagctaaggaccttttaactgcttatcaacttcctattccc
ccctatcacgtagcgacctccgtacctgaagtagaaacagcgattcaagccgaacaatgg
aaagctggtgttgtgaaagcacaggttcatgctggaggaagaggaaaaaatggaggggtg
gttattgcgcactctccggaagacttattagcagcagctgataagctactgcatatgcaa
ttttctagtaatcagacagcagggttgtctcttcctattaataaagtattgatttcccct
ttagtagagattgcttcggagtattatcttgcgatcgtcatcgatagaaaacatcgttgt
cctgtcattatgctatctaaagcaggaggtgtggatatcgaggaagtcgcagaaaagcag
ccggatcagctgcttaaaatgacactaccttcttctggaaaaatttatgggtatcagtta
cgccgtattgctaagttcatggagtgggatcaacctattgccgatcaagggaatcgtatc
attcgccagttattacaatgtttttatgaaaaggatgcttctttattagagattaatcca
ttggtacttactaaagacgggtctcttgtcattctagatgccaaaatgacgattgatgac
aatgctctttatcgacatcctcagctagcagactgctatgatccttctcaggaaaatatt
cgtgacgtactagctaagcagttaggcctttcatacattgctctagatggaacaatcgga
tgtttagtcaatggtgcaggattagcgatgagcaccttagatattctgaagttatatggc
ggttctgctgccaatttcttagatgtaggaggaagtgcttctgaaaagcaaattcaagaa
gccatctctttagtcttatctgataaaagtgtgcgcgtgctctttatccatatttttggg
gggattatggattgtgcagtcgtcgcttctggacttgtttctgctatgcaaggacagaaa
gaaacgatccctactgtaattcggttagaagggacgaatgtagataaaggaaaggacatg
attattaacgcaggaattccttgtgagttcgttacatccatgagcgagggggctgaactc
gctgtgcaattaagtcgttag

DBGET integrated database retrieval system