KEGG   Chlamydia trachomatis G/9768: G9768_02375Help
Entry
G9768_02375       CDS       T01907                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ctw  Chlamydia trachomatis G/9768
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    G9768_02375
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G9768_02375
Enzymes [BR:ctw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     G9768_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(529973..531307)
Genome map
AA seq 444 aa AA seqDB search
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDVRQTVDLCRVL
GAIVEWDQQAQVIEILTPRILLSKVPPQFSCVNRIPILLLGALLRRCPYGIFVPILGGDA
IGPRTLHFHLEGLKKLGAEIVISDEGYWASAPNGLVGAHITLPYPSVGATENLILASVGA
QGRTIIKNAALEVEIIDLIVFLQKAGVEITTDNDKTIEIFGCQDFYSVEHSIIPDKIEAA
SFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALIAEGGASWIENTEMLDRGY
TDWRGKLERLGAKVLARDSVSVYV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtatcaaggtttttggagaaacggtcttaagagggtctgtgcgcgtgtcagga
gctaaaaatgctacaactaaattacttgtagcctccttactttcggatcagcgaacgatt
ttaaagaacgtccctaatattgaagatgttcggcaaacggtagatctttgtcgggtttta
ggggcgattgtagagtgggatcagcaagcgcaagtgattgaaattctcactccgcgcatt
ttattgtccaaggttcctccgcaattttcttgtgttaatcggattcctattttgctgtta
ggagcgttgttacgtcgttgtccttatgggatttttgttcctattttgggaggggatgct
ataggacctcgtacgctacatttccatttagaaggattgaagaagcttggagcagagata
gtaattagtgatgaaggctattgggcttcagctccaaatggtcttgttggagcacacatc
acgttaccctacccttctgtgggagccacagaaaacctcatccttgcttctgtaggggct
caaggacgaacgattattaagaatgctgctcttgaagtggaaatcattgatttgattgtc
tttttacagaaagctggcgtggagattacaacagataatgataagaccatcgaaattttt
ggatgtcaggatttctattctgttgagcactccattattccagataaaatcgaggctgct
tctttcggtatggctgcggtagtttctcaggggaggatcttcgtagaacaagcgcgccat
gagcatatgatcccttttttaaaggtattaagatcgataggagggggattctctgtacat
gagaatgggatcgaatttttctacgataagcctttgaaagggggagttcttctagaaacg
gatgtgcatccagggtttattacagattggcaacaaccttttgccgtattgctctctcag
tcagaaggttgttcggtgatccatgagacagtgcatgagaatcgtcttgggtatttgaaa
ggtttggtaaaaatgggagcgcattgtgatttatttcacgagtgtttgagtgctaagtcg
tgtcgctattctacagggaatcatcctcatagcgcagtcattcatggtccgactcctttg
caggcaacagacttagtgattcctgatttgcgcgcaggatttgcttatgtcatggccgca
ctcattgcagaaggcggagcctcatggattgagaataccgagatgctggatcgagggtac
actgattggcgagggaaattagaaagattaggagctaaggttttagcgcgagactcagta
tctgtgtatgtttaa

DBGET integrated database retrieval system