KEGG   Chlamydia trachomatis G/9768: G9768_04100Help
Entry
G9768_04100       CDS       T01907                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctw  Chlamydia trachomatis G/9768
Pathway
ctw00920  Sulfur metabolism
ctw01100  Metabolic pathways
ctw01120  Microbial metabolism in diverse environments
ctw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    G9768_04100
Enzymes [BR:ctw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     G9768_04100
Transfer RNA biogenesis [BR:ctw03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    G9768_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P zf-BED
Motif
Other DBs
NCBI-ProteinID: ADH18497
Position
complement(907918..908946)
Genome map
AA seq 342 aa AA seqDB search
MFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPADYAIQYYFYQKLT
SLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSPESSHSSLFWLTD
PIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSENNSFKIYSAAKGEGLTICNPTHS
FPFSLHEDFQPTCKFCEASLSARNHQHLTTHILSKHLPWNPQPIRADSQCKYAWVADNTV
DFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLYLDRHPLILASAN
EQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcctcaatgactgccaaaaagctgcggaaacagttgtcatgcaggctatg
ctgtcactgatgcgctatcgaaaagctcataaatttattcccttttggaaaaagcctgac
cagacatacgttactcccgctgattacgctatccaatattatttttaccaaaaactgaca
tctttatttccgcatatcccgctggtcggagaagaaactctcaatcctgccacggatcac
cctaggatccctcaaatcctacaatttgcgcagcagctcgatcccaaagtctcctgtcaa
gatttgtatcaggccctctctccggaaagctcccactcttcactattttggttaacggac
cctatcgacggtacttcgggattcatcaaacaacgttgtttcgccatcgctctttctcta
ttttacgaacatactcctgttctctccgttatcgcttgcccttcttctgaaaataactct
ttcaaaatctattcggcagccaaaggcgaaggacttacgatttgtaatcctacccattcc
ttccccttctccctgcacgaagatttccaacctacctgtaaattctgtgaagcctcctta
tcagctagaaaccatcaacatttaactacacatattctcagtaaacatctcccttggaat
cctcagcctatccgagcagatagtcaatgcaaatacgcttgggttgcagataatacggta
gacttcttcattcgcatcccgtattcccctccacgagcccactacagagaccatgctccc
ggtgtgtttcttatagaagaagctggaggcctcgttacagatatatcggggaatcctctc
cctttttctaatccaaatttatatctagatagacatcctttgattcttgcttctgctaac
gagcaaatgcatagcacgattttagagactctatacaaactacgtcaccaagctactcaa
aacatgctcccccttgccactcatatctctgctactaagcataaacagctaagcgctctt
caactatag

DBGET integrated database retrieval system