KEGG   Chlamydia trachomatis G/9768: G9768_04260Help
Entry
G9768_04260       CDS       T01907                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctw  Chlamydia trachomatis G/9768
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G9768_04260
Enzymes [BR:ctw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     G9768_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940139..941005
Genome map
AA seq 288 aa AA seqDB search
MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLQVINACHLETP
SNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDE
EMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRYVLYFSSEGVLTSRAFAAV
QPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHIGLTGSGATLFVRY
PEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcactttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaa
gatgattttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctcc
ttatcaataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcct
agtaattctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcct
gttagttggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagt
aatgcagcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgag
gaaatgcgttccttagccgaacagcttggcgtggatactccttttttcttttctacagga
gcagccttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagat
agatatgttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgta
caaccttcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaag
cctgtttttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgg
gcggaacttcctgtgcatatagggctaacgggatcaggggcaaccttatttgtccgttac
ccagaaatcttagagaaagacctttcttatgcagctcagatacaaagagcagtaacgtta
agcggaggattattgacttctccgatacgaagagatcctacagcttggtatagcatctat
tctgaaagtgcacttgcagctacataa

DBGET integrated database retrieval system