KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0023Help
Entry
Clo1313_0023      CDS       T01933                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0023
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0023
   00020 Citrate cycle (TCA cycle)
    Clo1313_0023
   00620 Pyruvate metabolism
    Clo1313_0023
   00640 Propanoate metabolism
    Clo1313_0023
   00650 Butanoate metabolism
    Clo1313_0023
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0023
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1313_0023
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1313_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24124..25059
Genome map
AA seq 311 aa AA seqDB search
MAYNLKEVAKKPERLTGGHRMCAGCGAPIVVRQVLKALKPEDHAVISAATGCLEVSTFIY
PYTAWKDSFIHSAFENTGATISGAEAAYKVLKKKGKIEGETKFIAFGGDGGTYDIGLQAL
SGAMERGHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTSPVGKKIPGKMQPRKDLTEVL
VNHRIPYVAQTAPFGNMKDLYEKAEKAIYTPGPAFLNVLAPCPRGWRYNTPDLMELSKLA
VETCFWPLYEVIDGKYIINYKPKEKVPVKEFLKLQGRFKHLFKAGNEYMLEEIQKEVDLR
WERLLKLAGEA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatttgaaagaagttgcaaaaaaaccggaaagacttacgggcggacacaga
atgtgtgcaggctgcggagctccgatagttgtaagacaggttcttaaggcattaaaaccg
gaagatcatgcggttatctcagctgcaacaggttgtttggaagtttcaactttcatttac
ccttatacagcatggaaggattctttcattcacagtgcgtttgaaaataccggtgctaca
atttccggtgcggaagcggcttataaagtattgaagaaaaaaggaaaaattgaaggggag
accaagtttattgcgttcggtggtgacggcggaacatacgacataggacttcaggcactc
tcaggagcgatggaaagaggacacgacatggtttatgtgtgctacgacaatggagcatac
atgaacacaggtatccagaggtcttctgccactccgaaatacgctgataccacaacttca
cctgttggaaagaagatacccggtaaaatgcagccaagaaaagacctgacagaagtattg
gtaaatcatcgcataccttatgttgctcaaaccgctcctttcgggaacatgaaggacctc
tatgaaaaagctgaaaaagctatttatacacccggtcctgcgttcctgaacgtgttggca
ccgtgcccgagaggatggagatacaacactcctgatttgatggaattgagcaaattggcg
gttgaaacttgcttctggccgctttatgaagtaattgacggcaaatatataataaactac
aagccgaaggaaaaagttcccgtcaaggaattcttgaaacttcagggaagatttaaacat
cttttcaaagccggcaacgaatatatgctggaagaaattcagaaagaagtcgacttaaga
tgggagagactcttgaagctggccggagaggcttaa

DBGET integrated database retrieval system