KEGG   Clostridium thermocellum DSM 1313: Clo1313_0034Help
Entry
Clo1313_0034      CDS       T01933                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ctx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35989..36825
Genome map
AA seq 278 aa AA seqDB search
MKAHAKINLSLDVIGKRQDGYHEVRMIMQSIALHDEVVIEKRAAGIKVECDKPWVPEGSG
NIAYKAANLMMERYKIESGVGIKILKRIPVAAGLAGGSADAAAVIKGMNELFNLNADEAE
LMDIGKQVGADVPFCIKGGTMLSEGIGEKLTKIPSFEGVNIVLVKPKVGVSTAWVYSNLK
LNEISSRPDTELLIKAIYEKNIGCLAQNMTNVLETVTIKKYGVINDIKNELLRLGALGSM
MSGSGPSVFGIFENEKQACLAYEGLKNSEWECFVTQTI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcccatgcaaaaattaatttgtcccttgatgtaattggaaagagacaggatggt
tatcatgaggtcagaatgattatgcagtccatagctttgcatgacgaagttgtaatcgaa
aaaagggctgcaggaatcaaagtggaatgcgacaagccgtgggtgcccgaaggaagcggc
aatattgcttataaagcggcaaacctcatgatggaaaggtataagattgaaagcggcgtt
ggcattaaaatcctaaagagaattcccgtggcggcaggccttgcagggggaagtgccgat
gcggcggcggtaattaaagggatgaatgaactttttaatttgaatgctgatgaagccgaa
cttatggacatcggaaagcaggtgggagcggatgtgcctttctgcatcaagggaggaacc
atgctctccgaaggaatcggggagaagcttacaaaaatcccttcttttgagggagtgaat
attgtattggtaaaacccaaagtcggcgtgtcgacagcctgggtatacagcaatttaaag
ctgaatgaaatatcctcaagacctgataccgaacttttgataaaagcaatttatgagaaa
aatattggctgtctggcgcaaaacatgacaaatgtgctggagacagttacaataaaaaag
tatggagttataaatgatattaaaaacgagctcttgaggctcggagctttgggaagcatg
atgagcggaagcggtccttccgtgtttggcatatttgaaaatgaaaaacaggcttgtctt
gcttatgaaggccttaaaaacagtgagtgggaatgctttgttacacaaacaatataa

DBGET integrated database retrieval system