KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0073Help
Entry
Clo1313_0073      CDS       T01933                                 

Definition
Carbohydrate kinase, FGGY-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clo1313_0073
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Clo1313_0073
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clo1313_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78258..79742
Genome map
AA seq 494 aa AA seqDB search
MNNFYVLSIDQSTQGTKAVILNDSGIIQARHDLPHKQIINENGWVSHDPEEIYENVIKTV
KMVVEKAGIDKNRILCVGISNQRETTVVWDKKTGKPLCNAIVWQCNRAKDICERIKKAGY
ENCIAAKSGLKLSPYYPAGKMTWFMENVPDVDKKADDGDAAFGTIDSWLVYKLTKGKSYK
TDYSNASRTQLLNLTTLKWDEQLCDIFGIPVKALPEICDSNSVFGETDFEGYLEKPIPIC
GVLGDSHGALFGHNCRKEGSIKVTYGTGSSVMLNTGNIPIFSKHGLSTSLAWVIDGKASY
VLEGNINYTGAVISWLKDALGLIQSAKETAELSKRANPNDGTYLVPAFTGLGAPYWKSEA
KAIIAGMSRSTGKAELVKAANESIAYQINDVILAMRKDTGLEISELCVDGGPTRDDYLMQ
FQSDISDADIKIPNIEELSATGAAFLAGMSANLYDDTVYNAISYRFYHSKMNSQVRNEKV
DGWKAAVNMLLSKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttttacgttctcagcatagatcagagcactcaagggactaaagcggttatt
ctaaacgactctggaattattcaagcaagacatgatctcccacataagcaaatcataaat
gaaaatggatgggtttcccatgatccggaagaaatctatgaaaatgtaattaagaccgtg
aaaatggtagtggaaaaagcaggcatagataaaaaccggattctttgcgtgggaatttca
aaccagagagagacaacagtcgtatgggacaagaaaacaggcaagcctctttgcaatgca
attgtttggcaatgcaacagagcaaaagatatttgtgaaagaataaaaaaggcgggatac
gagaattgtatagccgcaaaatcgggtttaaagctttctccgtattatccggccggtaag
atgacatggtttatggagaatgttccggatgtagacaaaaaagcagatgacggagatgcg
gcttttggaacaatagatagctggcttgtttataaactgacaaagggaaaaagttataaa
accgattattcaaatgccagtcgtacccagcttttaaatttaaccacactgaagtgggat
gaacaactctgcgacatatttggaataccggttaaagcacttcctgagatttgtgattca
aattcagtgtttggcgaaactgattttgaaggttatcttgaaaagcccattccaatctgc
ggggtacttggggattcccatggtgcgttgtttggacacaactgcagaaaagaaggttcg
ataaaagttacttatggaacaggctcatccgttatgctaaacacgggcaacataccgatt
ttcagcaaacatggattatccacctctcttgcctgggtaatcgacggaaaagcttcttat
gttctcgaaggcaatattaactataccggtgcggttatttcatggcttaaagatgctctt
ggattgattcagtctgcgaaagaaacggctgagttgtcaaaaagggcaaacccaaatgat
ggaacttatttggttcccgcatttaccggtttgggggctccgtactggaaaagcgaagcc
aaggcgatcattgccggaatgagccgttcgaccggcaaagcagagctggtgaaagcggct
aatgaatctattgcttatcaaattaatgatgttattttggcaatgcgaaaagatacgggg
ttggaaatttcggaattgtgtgttgacggaggaccgaccagggatgattatctgatgcag
ttccagagcgatatttctgatgcagatattaaaatacccaatattgaggagctttctgca
acaggagcggcttttctggccggaatgtcagccaatctgtatgatgacaccgtgtataat
gccatatcatatcgattttaccattccaaaatgaattctcaagtacgcaatgaaaaagtt
gatggttggaaagcagcagtaaatatgcttttaagcaaggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system