KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0111Help
Entry
Clo1313_0111      CDS       T01933                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00860  Porphyrin and chlorophyll metabolism
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clo1313_0111
Enzymes [BR:ctx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Clo1313_0111
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Clo1313_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ADU73208
Position
125001..126482
Genome map
AA seq 493 aa AA seqDB search
MADGKGKVYLVGAGPGDEELLTVKAADVIKKADVIVYDRLISDGILSKIPDNAEKIYVGK
NAGNHPVPQHEINKILLAKALEAKIVVRLKGGDPFVFGRGGEELEFLHQNGIPFEVVPGI
TSAIAAAAYAGIPVTHRDFCSSLHIITGHVKDGGNPDIDYESLVKLKGTLIFMMSVASFP
QIAQGLIEAGMESDMDAAVIENGTMPNQRKFVSKLCDIPKVIAENQVKSPAIIIVGKVCS
LSEKLDWFSKLPLYGCNVLVTGPKKTSERLAGKLRGLGAHVVEYPCIETEPLDFDIDIRE
HSWIIFTSSLGVTIFFKKLYENKLDSRYLYNKKIAAVGSQTAEELLKHGICADFVPGKFD
GRHLAEELLQSGKISPEDKVVIFRAKDGTQAIVDIFENNNIHYTDISVYETKCIENERID
ISGFNYITFTSESCVKGFAHSFKNTIDYSKINAICIGEQTAKATRAYGMNTIISDVATVS
SMVEKIIEMHCAK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggcaaaggaaaggtttacctggtgggagcgggaccgggagatgaggaactt
cttactgttaaggcagccgatgttataaaaaaggcggatgtcatagtttatgacagactt
ataagcgatggtattctttcaaaaattcccgacaatgcggagaaaatctatgttggaaaa
aatgccggcaatcatccggttcctcagcatgaaataaataaaatccttctggccaaagca
ctggaagctaaaattgttgttaggcttaaaggcggcgatccctttgtatttggcagaggg
ggagaggagctggagttcttgcatcaaaacggcataccttttgaggtagtgccgggcatt
acttcggcaatagccgcagcagcatatgcaggcattcctgtcacccatagagatttttgc
tcgtcgctgcatattataaccggacatgtaaaagacggcggaaatccggacatcgactat
gaatctttagtgaagctaaaaggaactctcatctttatgatgtcggtggcctcatttccg
caaatagcacagggccttatagaagccggcatggaatccgatatggatgcggcagtgata
gaaaacggcacaatgccaaaccaaagaaaatttgtttcaaagctttgtgacatcccgaaa
gttatcgcagaaaatcaggttaaatcccctgcaataatcatagtcggaaaggtatgttcc
ctttctgaaaagcttgattggttttcaaaattgcctctttacggatgcaatgtattggta
acaggcccaaagaaaacatcggagagattggcaggcaaactccgagggctcggagcacat
gtagttgaatatccttgcatagaaacagaaccactcgactttgacattgatatacgagag
catagctggataattttcacaagcagcctgggtgtaacaatattctttaaaaaactgtat
gaaaacaagcttgacagcagatatttgtacaataaaaaaattgcagcggtaggctcccag
accgccgaagaactgttaaaacacggaatatgcgccgactttgttcccggtaaatttgac
ggcagacatttagcggaagagcttttgcaaagcggcaaaataagccctgaagacaaagtg
gttattttcagggcaaaggacggaacccaggccattgtagatattttcgaaaacaataat
atacactacactgatatctctgtatatgaaactaaatgcatagaaaatgagagaattgac
ataagtggttttaattatattacttttaccagcgaaagctgcgtaaaaggctttgcccac
tcctttaaaaacacaatagattattcaaaaatcaatgcaatatgcattggagaacaaaca
gccaaagctacaagggcttatggaatgaacacaattatttccgatgttgcaacggtttct
tcaatggttgaaaaaattattgaaatgcattgcgctaaataa

DBGET integrated database retrieval system