KEGG   Clostridium thermocellum DSM 1313: Clo1313_0168Help
Entry
Clo1313_0168      CDS       T01933                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ctx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184437..185618
Genome map
AA seq 393 aa AA seqDB search
MINARIVYINDMHEAKEEIRKIGVDASAITWLSPKALSIAIKLENVSSYEANILKQEMLA
KGGDAAVNRGVANFSTESSDVLLMGTYSQFNKLVYKLRMHGGSFKEITDEIQRLLEGLEK
GKPEYFECGKYRLPIGEKTYVMGILNVTPDSFSDGGKYLDIDSAVKRAREMVDEGADIID
VGGESTRPGHQPVDALEEINRVIPVIERLSKELNVPISVDTSKARVAEKALCAGACIVND
VWGLQRDPDMAEVVSKYGAGVIMMHNSDTKEYKDLMGDIIRFLRKSVEIAEKAGITRENM
VIDPGIGFGKTLEHNLEVMRRMRELNTLNLPVLLGTSRKSMIGNVLDLPVNERLEGTAAT
ITLGIANGADIVRVHDVKEMVRVARMTDAMVRV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgataaacgcaagaattgtctacataaatgatatgcatgaagcaaaagaagaaatccgc
aaaatcggtgtggatgcgtcagccataacatggctttcacccaaagcattgtccattgca
ataaagcttgagaatgtaagctcttatgaggcaaacatactcaagcaggaaatgctggcc
aagggcggagatgccgccgtaaacagaggtgtggcaaatttcagcacggaaagctccgat
gttctcctgatgggcacatacagccagtttaacaaacttgtgtacaagcttcgcatgcac
ggcggaagtttcaaggaaattaccgatgaaattcaaaggcttctggaaggtttggagaag
ggaaagccggagtattttgagtgcggcaagtatagactgcccataggagaaaaaacttat
gtgatgggaatactcaatgttacaccggattctttctccgacggtggaaaatatcttgat
attgacagtgcggtaaaaagagccagggaaatggtggatgaaggcgccgacataatagat
gtgggaggagagtcgacgaggcccggacatcagccggttgatgccctggaggaaataaac
cgggtgataccggttatagaaaggctttcaaaggagctgaatgtacccatatcggttgac
accagcaaggcccgggttgcggaaaaagctctttgtgcgggtgcctgcattgtaaatgac
gtttggggcctccagagggacccggacatggcggaggttgtatcaaagtacggtgcggga
gtaattatgatgcacaacagtgacaccaaagaatacaaggacctaatgggcgacattata
agatttttgagaaagagtgttgaaatagccgaaaaggccggaatcaccagggaaaatatg
gttattgaccccggaataggctttggaaagactttggagcacaacctggaagtaatgaga
agaatgagggaactaaacaccctaaaccttccggttcttcttgggacatcaagaaagtcc
atgataggaaatgttttggatttgcctgtaaatgaaaggcttgaagggactgccgcaacc
attacccttggtattgccaacggggcggatatagtgagagtccacgatgtaaaggaaatg
gtgcgggtggcaaggatgaccgatgctatggtaagagtttga

DBGET integrated database retrieval system