KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0383Help
Entry
Clo1313_0383      CDS       T01933                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0383
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0383
   00020 Citrate cycle (TCA cycle)
    Clo1313_0383
   00620 Pyruvate metabolism
    Clo1313_0383
   00640 Propanoate metabolism
    Clo1313_0383
   00650 Butanoate metabolism
    Clo1313_0383
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0383
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1313_0383
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1313_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
417187..417498
Genome map
AA seq 103 aa AA seqDB search
MNRPELREYVKPKHIKDYPVGPCYTAGYLVTENSGWRTEKPVVENAGCIGCFYCYLCCPE
GVIFKKGKAVDIDYAFCKGCGICARVCPKKAIKMVREEKNHGR
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcccgaacttagagagtatgttaaaccaaagcatattaaagattatcctgtg
ggtccctgctatacggcagggtatcttgtaaccgaaaattcaggttggagaacggaaaag
cccgttgtggaaaatgccgggtgtatcggttgcttttactgctatctttgctgcccggaa
ggagtaatattcaaaaaggggaaggcagtggatattgactatgccttttgcaaggggtgc
ggcatatgtgccagggtttgccccaaaaaagcaataaaaatggtaagagaggagaaaaac
catgggagataa

DBGET integrated database retrieval system