KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0383Help
Entry
Clo1313_0383      CDS       T01933                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0383
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0383
   00020 Citrate cycle (TCA cycle)
    Clo1313_0383
   00620 Pyruvate metabolism
    Clo1313_0383
   00640 Propanoate metabolism
    Clo1313_0383
   00650 Butanoate metabolism
    Clo1313_0383
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0383
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1313_0383
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1313_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417187..417498
Genome map
AA seq 103 aa AA seqDB search
MNRPELREYVKPKHIKDYPVGPCYTAGYLVTENSGWRTEKPVVENAGCIGCFYCYLCCPE
GVIFKKGKAVDIDYAFCKGCGICARVCPKKAIKMVREEKNHGR
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcccgaacttagagagtatgttaaaccaaagcatattaaagattatcctgtg
ggtccctgctatacggcagggtatcttgtaaccgaaaattcaggttggagaacggaaaag
cccgttgtggaaaatgccgggtgtatcggttgcttttactgctatctttgctgcccggaa
ggagtaatattcaaaaaggggaaggcagtggatattgactatgccttttgcaaggggtgc
ggcatatgtgccagggtttgccccaaaaaagcaataaaaatggtaagagaggagaaaaac
catgggagataa

DBGET integrated database retrieval system