KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0423Help
Entry
Clo1313_0423      CDS       T01933                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1313_0423
  Amino acid metabolism
   00340 Histidine metabolism
    Clo1313_0423
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Clo1313_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477973..479280
Genome map
AA seq 435 aa AA seqDB search
MIKIIDLRCGKDSDIFENLASRSQLEYRDVLDRVEEIVANVRRNGDKAVLEYTAMFDKVQ
LTLGKLRVTEKEIKEAYTKVDPKLVEVIKRSRDNIWNFHEKQKEKSWFSTEKEGVIVGQL
YRPLEVVGVYVPGGTAAYPSSVLMCAVPAKVAGVSKIVMTTPPGKDEKINPAILVAANEA
GVDEIYKVGGAQAVAALAFGTETIPKVDKIVGPGNIYVAMAKRTVYGYCDIDMIAGPSEI
MVVADETANPVFVAADLLSQAEHDILASSILVTTSEDIAKEVQRELEAQLAVLERKEIAG
KSIADYGAIIIVESLKDAATVVNRIAPEHLELCVKDPFAALGDIKNAGAIFLGNYSTEPL
GDYFAGPNHVLPTSGTARFFSPLNLSDFMKKSSIISYTRDALQKVKDDVILFAESEGLGA
HANAIRVRFQDGQDK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaattattgatttaagatgcggcaaagacagcgacatatttgaaaaccttgca
tcaagaagtcagctggagtatagggatgttttggaccgggtggaggagatagtggcaaat
gttcggcgaaacggagacaaagccgtgctggaatatacagccatgtttgacaaggttcag
ctcactttaggaaaattaagggttacggagaaagaaataaaagaggcgtacacaaaggtt
gaccccaaacttgttgaagtgataaaaaggtcaagggacaatatttggaattttcatgaa
aagcagaaggagaaatcctggttttccaccgaaaaggaaggggtaattgtcggacagctt
tacagacctttggaggttgtcggcgtgtatgttcccggcgggacagcggcctacccttca
tcggttctcatgtgcgcagtgcctgcaaaggtggccggtgtaagcaaaatagtaatgacc
acgcctcccggaaaggatgaaaagataaatcctgcaatactggtggcagccaatgaagcc
ggggttgatgaaatatacaaagtgggtggggcgcaggccgtagccgccctggcctttgga
acggagacaatcccgaaagtggacaaaattgtggggccggggaacatatatgtggcaatg
gcaaagaggacggtatacggctattgcgatattgacatgatagccggacccagcgagata
atggtggttgccgatgagaccgcaaatcctgtgtttgtggcggcggatcttttatcccag
gcagagcatgatatacttgcttcatcaattttggttacaacttctgaggatattgccaaa
gaggttcaaagggagcttgaggctcagctcgcggttttggaaagaaaagaaatagccgga
aaatcgatagctgactatggagcgataattattgtggaaagcctcaaggatgccgcgacg
gtggttaacagaattgcgccggagcatctggaactttgcgtaaaagatccctttgccgca
ctgggggatataaagaatgcgggtgcgatattccttggcaactattccacagagcctttg
ggagactattttgcaggacccaaccatgtgctccccacaagcggtacggcaagattcttc
tcacctttaaatctttcggattttatgaagaaaagcagcattatttcatatacaagagat
gcccttcaaaaggttaaagacgatgtcatactctttgcagagtccgaaggattgggagcc
catgcaaatgccattagagtgaggtttcaggacggacaggacaaataa

DBGET integrated database retrieval system