KEGG   Clostridium thermocellum DSM 1313: Clo1313_0489Help
Entry
Clo1313_0489      CDS       T01933                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ctx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctx00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ctx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctx00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ctx00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535317..536270
Genome map
AA seq 317 aa AA seqDB search
MYYIGIDLGGTNIAVGLVNEEGKILHKDSVPTLRERPYQEIIKDMAMLTLKVIKDADVSI
DQVKSIGVGSPGTPNCKDGILIYNNNLNFRNVPIRSEIQKYIDLPVYLDNDANCAALAES
VAGAAKGANTSVTITLGTGIGGGVVIDGKIYSGFNYAGGELGHTVLMMDGEPCTCGRKGC
WEAYASATALIRQARKAAEANPDSLINKLVGGDLSKIDAKIPFDAAKQGDKTGEMVVQQY
IRYIAEGLINMINIFMPEVLVIGGGVCKEGEYLLKPLRELIKQGVYSKEDIPQTELRTAQ
MGNDAGIIGAAMLGKEC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtattacatagggattgatcttggcggtacgaatatcgccgtgggtttggtaaatgag
gaaggaaaaatacttcacaaggacagcgttcccacgctgagggaaagaccgtatcaggaa
ataatcaaagacatggcaatgcttaccttaaaagtaataaaggatgcagatgtcagcatt
gaccaggttaaaagcattggggtcggaagtcccggaaccccgaactgcaaggatggaatt
cttatctataacaataacttgaatttcagaaatgttccgataaggtctgaaatacaaaaa
tatattgatttgcccgtataccttgacaatgacgcaaactgtgcggcacttgccgaaagt
gtggcaggggcggcaaaaggcgcaaacacatccgtaaccataaccttgggtacgggaata
ggcggaggagtcgtaatagacggcaaaatatacagcggtttcaactatgcgggaggagaa
ctggggcatactgttttgatgatggacggtgagccttgcacctgcggaagaaaaggctgc
tgggaagcatatgcgtcggcaacggctcttataaggcaggccagaaaggcggccgaggca
aatcccgattcacttataaacaagcttgtgggaggggatttgtcaaaaattgatgcaaaa
attccttttgatgcggcaaagcagggagacaaaaccggcgagatggtggtgcagcaatat
ataagatatattgccgaaggccttatcaacatgataaatatatttatgcctgaggtactg
gtgataggtggaggagtatgcaaagaaggagaataccttttaaagcctctgagggaactt
ataaaacagggagtttacagtaaagaggatatacctcaaactgagctgagaacggcccaa
atgggcaatgacgccggaataatcggtgccgcaatgctggggaaagaatgttag

DBGET integrated database retrieval system