KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0489Help
Entry
Clo1313_0489      CDS       T01933                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00010  Glycolysis / Gluconeogenesis
ctx00052  Galactose metabolism
ctx00500  Starch and sucrose metabolism
ctx00520  Amino sugar and nucleotide sugar metabolism
ctx00521  Streptomycin biosynthesis
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01120  Microbial metabolism in diverse environments
ctx01130  Biosynthesis of antibiotics
ctx01200  Carbon metabolism
Module
ctx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0489
   00052 Galactose metabolism
    Clo1313_0489
   00500 Starch and sucrose metabolism
    Clo1313_0489
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1313_0489
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clo1313_0489
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Clo1313_0489
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Clo1313_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Hydant_A_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADU73578
Position
535317..536270
Genome map
AA seq 317 aa AA seqDB search
MYYIGIDLGGTNIAVGLVNEEGKILHKDSVPTLRERPYQEIIKDMAMLTLKVIKDADVSI
DQVKSIGVGSPGTPNCKDGILIYNNNLNFRNVPIRSEIQKYIDLPVYLDNDANCAALAES
VAGAAKGANTSVTITLGTGIGGGVVIDGKIYSGFNYAGGELGHTVLMMDGEPCTCGRKGC
WEAYASATALIRQARKAAEANPDSLINKLVGGDLSKIDAKIPFDAAKQGDKTGEMVVQQY
IRYIAEGLINMINIFMPEVLVIGGGVCKEGEYLLKPLRELIKQGVYSKEDIPQTELRTAQ
MGNDAGIIGAAMLGKEC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtattacatagggattgatcttggcggtacgaatatcgccgtgggtttggtaaatgag
gaaggaaaaatacttcacaaggacagcgttcccacgctgagggaaagaccgtatcaggaa
ataatcaaagacatggcaatgcttaccttaaaagtaataaaggatgcagatgtcagcatt
gaccaggttaaaagcattggggtcggaagtcccggaaccccgaactgcaaggatggaatt
cttatctataacaataacttgaatttcagaaatgttccgataaggtctgaaatacaaaaa
tatattgatttgcccgtataccttgacaatgacgcaaactgtgcggcacttgccgaaagt
gtggcaggggcggcaaaaggcgcaaacacatccgtaaccataaccttgggtacgggaata
ggcggaggagtcgtaatagacggcaaaatatacagcggtttcaactatgcgggaggagaa
ctggggcatactgttttgatgatggacggtgagccttgcacctgcggaagaaaaggctgc
tgggaagcatatgcgtcggcaacggctcttataaggcaggccagaaaggcggccgaggca
aatcccgattcacttataaacaagcttgtgggaggggatttgtcaaaaattgatgcaaaa
attccttttgatgcggcaaagcagggagacaaaaccggcgagatggtggtgcagcaatat
ataagatatattgccgaaggccttatcaacatgataaatatatttatgcctgaggtactg
gtgataggtggaggagtatgcaaagaaggagaataccttttaaagcctctgagggaactt
ataaaacagggagtttacagtaaagaggatatacctcaaactgagctgagaacggcccaa
atgggcaatgacgccggaataatcggtgccgcaatgctggggaaagaatgttag

DBGET integrated database retrieval system