KEGG   Clostridium thermocellum DSM 1313: Clo1313_0500Help
Entry
Clo1313_0500      CDS       T01933                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ctx00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548762..550465)
Genome map
AA seq 567 aa AA seqDB search
MIKNKKILLLLCINLCLFFLLINRIQLVSSAAVNADIIVAKDGTGNFTTIQAAIDSVPSN
SSKRTVIFVKNGTYKEVVTIRKNNIHLIGESNTKTIITYDNYAGKLKPDGTTYGTSGSAS
FYLYGTDTILENITIENSFDESIDVKDKQAVAAYIRGDRQIIKNCIFIGNQDTLYAHSGR
QYYVNCKIIGDTDFIFGGATAVFENCEIVSTPKGGYVTAASTDLENYGFLFLNCRLTSDA
PKNSTYLGRPWRPNAYVVYKTCYLGAHIKESGWTSMSGNLPENARFFEYKNTGPGAVVNS
SRRQLSDAEAAKFTPQNLLKGTDNWNPVALVSQTPTLTPTQKPTSTPAPTPMDGQLIKSL
TVKDSANSSNWSIQSNLRVGDTVFGDRTYKFVTIPNEFLGSEWIRTACDSKKSTEDLAYF
TAKADITVYVGLDSRVATIPSWLNDWTKTSLTITDDGSPQVTYNLYKKNFSANSVVTLGP
NGASSGAVNYIVIVKQNNQNIVYGDLNGDGLVNSSDYSLLKRYILKQIDLTEDKLKAADL
NRNGSVDSVDYSILKRFLLKTITQLPV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacaaaaaaatattacttttactatgcattaatctttgcctgttcttttta
ctaatcaatagaattcagcttgtgtcttccgcagcggtcaatgcggatataatagttgcc
aaagacggtacaggcaatttcacaaccatacaggccgcaattgattcagtaccgtcaaac
agttcaaaaagaaccgttatatttgtcaaaaacggtacatacaaagaagttgttacaatc
aggaaaaacaacatacacctcatcggagaaagcaatacaaaaacaatcattacatatgac
aattatgcgggtaaactaaaacctgacggcaccacatacggtacatccggttccgcatca
ttctatctctatggaactgacacaatccttgaaaacatcacaattgaaaattcctttgat
gaaagtatcgacgtaaaagacaagcaagccgtagctgcttatatccgcggcgacaggcaa
ataatcaaaaattgtatttttatcggaaatcaggataccttgtatgcacactcgggcaga
cagtattatgtgaactgcaaaatcataggtgacacggattttatatttggcggcgccaca
gctgtatttgaaaactgcgaaattgtttcaacacccaaagggggatatgtcactgctgca
agcactgatctcgaaaattacggatttctgttcttaaactgcagattgacaagcgatgct
cccaaaaattcaacatatcttggaagaccctggcgtcccaatgcatatgtagtttacaaa
acatgttatttgggagcgcatataaaggagtccggctggaccagcatgagtggtaatttg
cctgaaaatgcgcgcttttttgagtacaaaaacacaggcccgggagcggtggtcaactca
tcgagaagacagttgtcagacgccgaagccgcaaaatttactccgcaaaacctattaaaa
ggtactgacaattggaatccggttgcgctcgtgtctcaaacgccaactttaacaccgact
caaaaacccacctcaacaccggctccaaccccaatggacggccaattgataaaatcatta
acggtaaaggattcggcaaattcgtccaattggtccatacagtcgaatttacgggttggt
gatacagtttttggtgacagaacatacaagtttgtcacaattccaaatgagttccttggc
tccgaatggatcaggacagcctgtgactcgaaaaaatccacagaagacctggcctacttt
accgccaaagctgacataaccgtatatgtgggtctggactcaagggttgcaaccataccg
tcatggcttaacgattggaccaaaacctcactgacaataaccgacgacggttcaccacag
gttacctacaacctttacaaaaagaatttcagtgcaaactccgttgtaacccttggtcct
aatggggcttcaagcggggctgtgaattatattgtcatagttaaacaaaacaatcaaaat
atagtatatggtgatttgaacggagacggactggtaaactcaagcgactattcattatta
aaaagatacatacttaaacaaatagatttgacggaggataaacttaaggcggcagacctg
aatagaaacggctccgttgactcagtggattattccatattaaagagatttttgttgaaa
acaattacacaattgcctgtataa

DBGET integrated database retrieval system