KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0739Help
Entry
Clo1313_0739      CDS       T01933                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clo1313_0739
Enzymes [BR:ctx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clo1313_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851647..853773
Genome map
AA seq 708 aa AA seqDB search
MDYLSGVVERITFVNEENGFSVVKIKSKGFSDLVTAVGNMASVNVGAVVSLRGEWKYDSK
FGRQFNVYHYEESIPATVAGIEKYLGSGLIKGIGPVNAKRIVKVFKEDTIRVIEEEPDRL
IEVPGIGKKRVEMIKEAWQNQKEIKNVMLFLQSHGVSTAFAVKIFKTYGSDSIKIVKENP
YRLADDIWGIGFKTADKIAQNMGYDKESYARIRSGIMYALNEFANDGHCFAKKDELVNKA
SELLGVELEKVETAIQHMLEEKSVIMEEDDAVYLPPFYYSEVGVARRIREIIETKSMYSF
YNFDGIIEDLQRECNIQYDEVQIEAIRKAVVSKFMVLTGGPGTGKTTTTLAIIKVFQKLG
ATVLLAAPTGRAAKRMSEATGMEAKTIHRLLEYSPQDGYKKNDDNPLECDVLIIDETSMI
DIILMYNLLKAVSNNTVVILVGDVDQLPSVGAGNVLKDIIESGMVTVVRLMRIFRQAMGS
AIVTNAHKINHGEYPVLKGGKNSNFFFIEEEDPEKIVELVRELCSKRLPGYYKINPLNDI
QVLCPMQKGVVGAQNLNTVLQETLNPCDISIKYGGTIYKLNDRVMQIKNNYDKNVFNGDM
GIITDIDQEEKTVRIKFDDAEVEYDVTELDEVTLAYAVTVHKSQGSEYNFVVAPFTMQHY
MMLQRNLLYTCVTRAKKSPRADRFKKGAGVLHKKFQKYGQKYQTCPKT
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggattacttgagcggagtcgtagaaaggataacatttgttaatgaagagaatggcttt
tctgtcgtaaaaataaagtcgaaaggtttttcagacctggtgacggcagtggggaatatg
gcttcggtaaatgtcggagccgtcgtaagccttcgaggggagtggaaatacgactctaag
tttggcaggcagttcaatgtataccattacgaagaatcaatacctgccactgttgccggt
attgaaaagtatttgggaagcggacttattaagggaatagggcctgttaatgccaaaagg
attgtaaaagtgtttaaagaagacaccataagggtaattgaggaggaacccgacaggctc
attgaagttccaggcatagggaaaaaacgggtggaaatgataaaagaggcgtggcagaat
caaaaggaaataaagaatgtcatgctttttttgcagtcccacggtgtttctacggcgttt
gccgtgaaaatatttaaaacatacggaagtgacagcataaaaattgtaaaggaaaaccca
tacagacttgcggatgacatatggggaatcggttttaaaaccgcggacaaaatagcccaa
aatatgggatatgacaaggagtcttatgcacgcatcaggtccggcataatgtatgcatta
aacgaatttgccaatgacggacattgctttgccaaaaaagacgaacttgtaaataaggct
tcggagctgcttggggttgagttggagaaagtggagactgccatacagcatatgctggaa
gagaaatccgtaataatggaagaagatgatgcggtttacctcccgcctttttattacagt
gaagtgggagttgccagaagaatacgggagataattgagactaaaagcatgtacagcttt
tacaattttgatgggataatagaggacctccaaagagaatgcaatattcaatatgacgaa
gtgcagattgaagccatcagaaaagcggttgtgtcaaaattcatggttcttaccggcggt
ccgggcaccggtaagactacaaccactcttgcgataataaaggtatttcaaaaactgggt
gccacagtcctccttgccgcaccaaccggaagagcggcaaagcgtatgtctgaagctacc
ggtatggaggcaaagaccatacaccgtttgctggaatacagtcctcaggacggatataaa
aaaaatgacgacaatcctttggagtgtgatgtgctaatcattgatgagacttcaatgatt
gacattatcttgatgtacaatcttcttaaagccgtttcaaacaatacggtggtgatactg
gttggggacgtggaccagcttccttcggtgggagcaggaaatgtactgaaagacattata
gaatcgggtatggtaactgtggtaaggcttatgaggatattccggcaggccatgggaagc
gcgatagtaaccaatgcgcataaaataaaccatggtgagtatccggtcttaaaaggcggc
aaaaacagtaactttttcttcattgaagaagaggacccggaaaagattgtagaacttgtc
cgggagctttgttcaaaacggcttcccggctactacaaaataaatcctctaaatgacatt
caggttttgtgtcccatgcaaaagggagtggtgggagcgcaaaatctcaatacagtgctt
caggagactctaaatccctgcgatatttccataaaatacggcggcacaatttacaaatta
aatgacagggtaatgcagattaagaacaattatgataaaaacgtatttaacggagacatg
gggataataacggacattgaccaggaagagaaaaccgtgcgcataaagtttgatgatgcc
gaggttgagtatgatgtgacggagctggacgaggttactctggcatatgcagtcacggtc
cataaaagccaggggagtgagtacaactttgtggtggcaccctttacaatgcagcattac
atgatgcttcaaagaaaccttttatacacatgcgttacaagagccaaaaaaagtcctcgt
gctgataggttcaaaaaaggcgctggggtgttgcataagaaattccagaagtatggacag
aaataccaaacttgcccaaagacttaa

DBGET integrated database retrieval system