KEGG   Clostridium thermocellum DSM 1313: Clo1313_0739Help
Entry
Clo1313_0739      CDS       T01933                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851647..853773
Genome map
AA seq 708 aa AA seqDB search
MDYLSGVVERITFVNEENGFSVVKIKSKGFSDLVTAVGNMASVNVGAVVSLRGEWKYDSK
FGRQFNVYHYEESIPATVAGIEKYLGSGLIKGIGPVNAKRIVKVFKEDTIRVIEEEPDRL
IEVPGIGKKRVEMIKEAWQNQKEIKNVMLFLQSHGVSTAFAVKIFKTYGSDSIKIVKENP
YRLADDIWGIGFKTADKIAQNMGYDKESYARIRSGIMYALNEFANDGHCFAKKDELVNKA
SELLGVELEKVETAIQHMLEEKSVIMEEDDAVYLPPFYYSEVGVARRIREIIETKSMYSF
YNFDGIIEDLQRECNIQYDEVQIEAIRKAVVSKFMVLTGGPGTGKTTTTLAIIKVFQKLG
ATVLLAAPTGRAAKRMSEATGMEAKTIHRLLEYSPQDGYKKNDDNPLECDVLIIDETSMI
DIILMYNLLKAVSNNTVVILVGDVDQLPSVGAGNVLKDIIESGMVTVVRLMRIFRQAMGS
AIVTNAHKINHGEYPVLKGGKNSNFFFIEEEDPEKIVELVRELCSKRLPGYYKINPLNDI
QVLCPMQKGVVGAQNLNTVLQETLNPCDISIKYGGTIYKLNDRVMQIKNNYDKNVFNGDM
GIITDIDQEEKTVRIKFDDAEVEYDVTELDEVTLAYAVTVHKSQGSEYNFVVAPFTMQHY
MMLQRNLLYTCVTRAKKSPRADRFKKGAGVLHKKFQKYGQKYQTCPKT
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggattacttgagcggagtcgtagaaaggataacatttgttaatgaagagaatggcttt
tctgtcgtaaaaataaagtcgaaaggtttttcagacctggtgacggcagtggggaatatg
gcttcggtaaatgtcggagccgtcgtaagccttcgaggggagtggaaatacgactctaag
tttggcaggcagttcaatgtataccattacgaagaatcaatacctgccactgttgccggt
attgaaaagtatttgggaagcggacttattaagggaatagggcctgttaatgccaaaagg
attgtaaaagtgtttaaagaagacaccataagggtaattgaggaggaacccgacaggctc
attgaagttccaggcatagggaaaaaacgggtggaaatgataaaagaggcgtggcagaat
caaaaggaaataaagaatgtcatgctttttttgcagtcccacggtgtttctacggcgttt
gccgtgaaaatatttaaaacatacggaagtgacagcataaaaattgtaaaggaaaaccca
tacagacttgcggatgacatatggggaatcggttttaaaaccgcggacaaaatagcccaa
aatatgggatatgacaaggagtcttatgcacgcatcaggtccggcataatgtatgcatta
aacgaatttgccaatgacggacattgctttgccaaaaaagacgaacttgtaaataaggct
tcggagctgcttggggttgagttggagaaagtggagactgccatacagcatatgctggaa
gagaaatccgtaataatggaagaagatgatgcggtttacctcccgcctttttattacagt
gaagtgggagttgccagaagaatacgggagataattgagactaaaagcatgtacagcttt
tacaattttgatgggataatagaggacctccaaagagaatgcaatattcaatatgacgaa
gtgcagattgaagccatcagaaaagcggttgtgtcaaaattcatggttcttaccggcggt
ccgggcaccggtaagactacaaccactcttgcgataataaaggtatttcaaaaactgggt
gccacagtcctccttgccgcaccaaccggaagagcggcaaagcgtatgtctgaagctacc
ggtatggaggcaaagaccatacaccgtttgctggaatacagtcctcaggacggatataaa
aaaaatgacgacaatcctttggagtgtgatgtgctaatcattgatgagacttcaatgatt
gacattatcttgatgtacaatcttcttaaagccgtttcaaacaatacggtggtgatactg
gttggggacgtggaccagcttccttcggtgggagcaggaaatgtactgaaagacattata
gaatcgggtatggtaactgtggtaaggcttatgaggatattccggcaggccatgggaagc
gcgatagtaaccaatgcgcataaaataaaccatggtgagtatccggtcttaaaaggcggc
aaaaacagtaactttttcttcattgaagaagaggacccggaaaagattgtagaacttgtc
cgggagctttgttcaaaacggcttcccggctactacaaaataaatcctctaaatgacatt
caggttttgtgtcccatgcaaaagggagtggtgggagcgcaaaatctcaatacagtgctt
caggagactctaaatccctgcgatatttccataaaatacggcggcacaatttacaaatta
aatgacagggtaatgcagattaagaacaattatgataaaaacgtatttaacggagacatg
gggataataacggacattgaccaggaagagaaaaccgtgcgcataaagtttgatgatgcc
gaggttgagtatgatgtgacggagctggacgaggttactctggcatatgcagtcacggtc
cataaaagccaggggagtgagtacaactttgtggtggcaccctttacaatgcagcattac
atgatgcttcaaagaaaccttttatacacatgcgttacaagagccaaaaaaagtcctcgt
gctgataggttcaaaaaaggcgctggggtgttgcataagaaattccagaagtatggacag
aaataccaaacttgcccaaagacttaa

DBGET integrated database retrieval system