KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0813Help
Entry
Clo1313_0813      CDS       T01933                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0813
   01230 Biosynthesis of amino acids
    Clo1313_0813
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0813
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0813
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1313_0813
Enzymes [BR:ctx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Clo1313_0813
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Clo1313_0813
  Exosomal proteins of melanoma cells
   Clo1313_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938423..939004
Genome map
AA seq 193 aa AA seqDB search
MTNVYFVRHAEPDYNVRDDFARPLTKKGKEDAKLVSSYLSDKDIHVVISSPYLRAIDTVK
DFAGEVGLDIKIVDDFRERKVGNVWIEDFNSFAKKQWEDFDYKLSDGESLREVQNRNIKA
LNEVLRMYEGKNIVIGTHGTALSTIINYYDSTYGYDDFERMKLIMPWIVKMQVKKDRCIN
ITKIDILNGGRSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgtatactttgtgaggcatgcggaaccggattacaatgtccgggatgatttt
gccagaccgttgactaaaaagggtaaagaagatgccaaattggtttcgtcgtatttaagc
gacaaagatattcatgtggtaatatcaagcccgtatttgcgggcaattgatacggtgaag
gattttgccggtgaagttggacttgatataaaaattgttgacgattttagagaacgaaaa
gtgggcaacgtttggatagaggactttaattcttttgcaaaaaagcaatgggaagatttt
gattacaagctgtcggacggagagagtttgagagaagttcaaaatcggaatataaaagca
ctaaacgaggttttacgcatgtatgaaggaaaaaacatagtaattgggacacatgggact
gcattgagcaccataataaattactatgacagtacttacgggtatgatgattttgaacga
atgaagctgataatgccctggattgtaaaaatgcaggttaaaaaagatagatgcataaat
attacaaaaatagacattttaaacggagggcgctctttataa

DBGET integrated database retrieval system