KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0813Help
Entry
Clo1313_0813      CDS       T01933                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0813
   01230 Biosynthesis of amino acids
    Clo1313_0813
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0813
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0813
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1313_0813
Enzymes [BR:ctx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Clo1313_0813
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Clo1313_0813
  Exosomal proteins of melanoma cells
   Clo1313_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
938423..939004
Genome map
AA seq 193 aa AA seqDB search
MTNVYFVRHAEPDYNVRDDFARPLTKKGKEDAKLVSSYLSDKDIHVVISSPYLRAIDTVK
DFAGEVGLDIKIVDDFRERKVGNVWIEDFNSFAKKQWEDFDYKLSDGESLREVQNRNIKA
LNEVLRMYEGKNIVIGTHGTALSTIINYYDSTYGYDDFERMKLIMPWIVKMQVKKDRCIN
ITKIDILNGGRSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgtatactttgtgaggcatgcggaaccggattacaatgtccgggatgatttt
gccagaccgttgactaaaaagggtaaagaagatgccaaattggtttcgtcgtatttaagc
gacaaagatattcatgtggtaatatcaagcccgtatttgcgggcaattgatacggtgaag
gattttgccggtgaagttggacttgatataaaaattgttgacgattttagagaacgaaaa
gtgggcaacgtttggatagaggactttaattcttttgcaaaaaagcaatgggaagatttt
gattacaagctgtcggacggagagagtttgagagaagttcaaaatcggaatataaaagca
ctaaacgaggttttacgcatgtatgaaggaaaaaacatagtaattgggacacatgggact
gcattgagcaccataataaattactatgacagtacttacgggtatgatgattttgaacga
atgaagctgataatgccctggattgtaaaaatgcaggttaaaaaagatagatgcataaat
attacaaaaatagacattttaaacggagggcgctctttataa

DBGET integrated database retrieval system