KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0836Help
Entry
Clo1313_0836      CDS       T01933                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1313_0836
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1313_0836
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1313_0836
Enzymes [BR:ctx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clo1313_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964167..965351
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGIHGGQYIPETLMNAVIELEEAYNHFKNDPDFLAELDDLLKNYAGRPSLLYYAE
KMTKDLNGAKIYLKREDLNHTGSHKINNVLGQVLLAKRMGKKRVIAETGAGQHGVATATA
AALMGLECEIFMGKEDTERQALNVFRMELLGAKVHAVTSGTQTLKDAVNETLREWSRRVH
DTHYVLGSVMGPHPFPTIVRDFQSVIGREIKKQIMEKEGKLPDVVMACVGGGSNAIGAFY
EFIGDSSVRLIGCEAAGKGLETGKHAATMSKGTLGIFHGMKSYFCQDEYGQIAPVYSISA
GLDYPGVGPEHAYLKDIGRAQYVAVTDDEAVEAFEYLSRTEGIIPAIESSHAVAYAMKLA
PTMSKDQIIVICLSGRGDKDVAAIARYRGVQIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaggaagatttggaatccacggcggacaatacattccggaaacattgatgaac
gccgtgattgagctggaagaggcatataaccactttaaaaacgaccccgactttttggcg
gaacttgacgacctgttgaaaaattatgcaggacgtccgtctttactttattatgcggaa
aagatgacaaaagacctgaacggagcaaaaatttatctgaaacgtgaggatctcaaccat
acaggttcgcataaaataaacaatgttttgggccaggtgcttcttgcaaaacgtatgggt
aaaaaacgcgtaattgccgagaccggcgccggacagcatggtgttgcgacggcaaccgct
gcggcgcttatgggattggaatgtgaaattttcatgggcaaggaggataccgagcgtcag
gcgttgaatgtatttaggatggagcttttgggcgcgaaagttcatgcagtgacaagcgga
acacagacacttaaagatgcggtaaatgagactttgagagagtggtcgagaagggttcat
gacactcattatgtgctgggttctgtcatgggaccacacccgtttcctaccattgtaagg
gattttcagagcgtaatcggccgggaaattaaaaagcagattatggagaaggaaggaaaa
cttcctgacgttgttatggcgtgtgtgggcggaggcagcaatgcaatcggagcgttttat
gagtttattggtgattcaagtgttcggcttatcggatgcgaggctgccggaaaagggttg
gaaaccggcaagcatgcggcaacaatgtcaaaaggtacattgggaattttccacggcatg
aagtcttatttctgccaggatgaatatggacagattgcaccggtttattctatttccgca
ggtctggactacccgggagtgggcccggaacatgcgtatctgaaggatattggaagggct
caatacgtagccgttaccgatgatgaggccgttgaggcgtttgaatacctttcccgaacc
gaaggtataattccggcaattgagagttcccatgcggttgcatatgcaatgaaacttgct
ccgacgatgagcaaagatcagataattgtaatttgcctttcgggaagaggcgataaagat
gttgcggcgatagcgcgttacaggggggttcaaatctatgaataa

DBGET integrated database retrieval system