KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0837Help
Entry
Clo1313_0837      CDS       T01933                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1313_0837
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1313_0837
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1313_0837
Enzymes [BR:ctx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clo1313_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965344..966114
Genome map
AA seq 256 aa AA seqDB search
MNKLERAFSNGKAFIPFITAGDPSLEITEQLVYRMAEAGADLIELGIPFSDPVAEGPVIQ
EADYRALSAGTTTDKIFDMVGRIRKSCDIPIAFMTYANPIFTYGSEKFLKRCGETGIDAL
IVPDIPFEEKEELAPFCKEYDVRFISMIAPTSKERIRMIAREAEGFIYCVSSMGVTGVRE
KIGDDAKEMIKIVKEVRDIPCAVGFGISTPEQAAQMAGFSDGVIVGSAIVKIIAQYGAEC
IPYVEEYVRKMKNAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagaacgggcgtttagcaacggaaaggcatttattccgttcattacggcg
ggcgatccgtcactggagataaccgaacagttggtgtatagaatggctgaagccggggcg
gatttaattgagctcggcataccgttttccgatccggtggcggagggacctgttattcag
gaggcagattaccgtgccctttcggcgggtactacaacggacaagatttttgacatggtg
ggacgcatacgtaaatcctgcgatatacctattgcttttatgacatatgccaatccgata
tttacttacggaagtgaaaagtttttgaaaagatgcggcgaaacaggaattgatgccctt
attgttcccgatattccttttgaggaaaaggaagaactggctcctttctgcaaagaatat
gatgtcagatttatctcaatgatagcacccacgtcaaaagagcgcatcagaatgattgcc
agggaagcggaaggctttatttactgtgtgtcgtccatgggtgttaccggtgtcagagag
aaaatcggtgatgatgccaaagaaatgataaaaattgtaaaagaggtcagagacattccg
tgtgccgttggatttggtatttccactccggagcaggctgctcagatggccggtttctcc
gacggagtgattgtaggaagtgcaattgtaaagattatagcccaatacggtgccgaatgc
ataccgtacgttgaagaatatgtgcgtaaaatgaaaaacgcaataaaataa

DBGET integrated database retrieval system