KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0867Help
Entry
Clo1313_0867      CDS       T01933                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00260  Glycine, serine and threonine metabolism
ctx00750  Vitamin B6 metabolism
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01120  Microbial metabolism in diverse environments
ctx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1313_0867
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clo1313_0867
Enzymes [BR:ctx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clo1313_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADU73935
Position
1006842..1008341
Genome map
AA seq 499 aa AA seqDB search
MYYESTRGGLKSVSSAEAIKRGIAPDGGLFVPENKVSFTGSEISAMADMSYQERALYILK
HYLTDYSDEEIADCVYNAYTDEKFDDKRIAPLVQLNENVNILELWHGPTCAFKDMALQIL
PHFLVKAVRKTGETGEIVILVATSGDTGKAALEGFKDVEGTRIIVFYPQDGVSQVQKMQM
VTQEGKNVYTIGVEGNFDDAQSGVKAIFTDEELKQKMDKGNFKFSSANSINWGRLVPQIV
YYFSAYADMLKNGEIKEGDKINFVVPTGNFGNILAAFYAMQMGLPVNRLICASNDNNVLT
DFINTGVYDKNREFKRTISPSMDILISSNLERLLFELTGHDPLPVNNWMSSLKETGKYTV
DNTMKKKISEIFWGGYSNEAETLKTIEAIYKEYGYVIDTHTAVGVDVYDKYVISTGDVTK
TVIASTASPFKFNESVVKAVLGNEALKGRTEFELLEVLAKECRLKIPEGLKDLDKKPVLH
KQVCSKFDMKQQVESILGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtattatgaaagtacacgagggggattaaaatctgtatcatctgctgaagctataaaa
aggggtatagcgccggacggtggattgtttgtcccggagaataaagtaagttttaccggt
agtgaaattagcgccatggctgatatgagttatcaggaaagggcgttatatatattaaag
cactatcttacggattatagcgatgaagaaatagcggactgtgtttacaatgcctatacc
gatgaaaagttcgacgacaaaagaattgctcccttggttcagctgaatgaaaatgtcaat
atcctggaattgtggcacggaccaacatgtgcattcaaagacatggcacttcaaatattg
cctcatttccttgtaaaggcagtgagaaaaaccggcgaaaccggtgaaatcgtaattttg
gttgcaacttcaggagataccggaaaagctgctttggaaggttttaaggatgttgagggc
acaagaataattgtgttctatccccaggatggcgtaagccaggttcagaaaatgcaaatg
gtcacccaggaaggaaaaaatgtttacaccataggagtggaaggaaattttgacgacgca
caaagcggagtaaaagcaatttttaccgatgaagaacttaagcagaaaatggacaaaggc
aatttcaaattttcatcggcgaattccattaactgggggagacttgtacctcagatagtc
tattatttttcggcatatgctgatatgctgaagaacggtgaaataaaagagggagacaag
attaactttgttgtccccacaggaaatttcggaaatattcttgcggctttctatgcaatg
caaatggggcttcctgtaaacaggctcatttgtgcgtccaatgacaataatgttttaacc
gattttatcaatacaggagtatatgacaaaaacagggagtttaagaggaccatttcgccg
tctatggacatattgatttcaagcaaccttgaaagactcctctttgaacttaccggacat
gatcctttgccggtgaacaattggatgagcagtttgaaagaaaccggaaaatatactgtt
gacaatacaatgaagaaaaagatatcggaaatattctggggcggatattcaaacgaggct
gaaactttaaagacgatagaggctatatacaaggaatacggatatgtcattgatacccat
actgctgtaggtgttgatgtgtatgacaaatatgtaatttccaccggtgacgtgacaaag
acggtcattgcgtcaacggcaagtcctttcaaatttaatgaaagtgtggtaaaagcagtt
ttgggaaatgaagcgttaaaaggaaggacggaatttgaacttcttgaggttttggcaaaa
gagtgcaggcttaaaataccggaaggtttgaaagatcttgacaaaaagcctgtgcttcac
aaacaggtttgcagtaaatttgatatgaaacagcaggttgaaagtattcttggtctgtaa

DBGET integrated database retrieval system