KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0941Help
Entry
Clo1313_0941      CDS       T01933                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Clo1313_0941
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Clo1313_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096887..1097498
Genome map
AA seq 203 aa AA seqDB search
MYREGLLVVVSGPSGAGKGTLLNLLKDSGDDNIRFSVSATTRAPRVGEVDGVNYFFKTKE
EFMLMIENDELFEWVEYCDNFYGTPKKYIEDTIKGGYDCLLEIEVEGAAKVMKAYPECVS
VFILPPSFEELRRRIEKRGTEDVEVVNKRLERAKKEIAYASNYDYIIVNDNLKDAVEGLR
SIIKAEKLKLKRNRDVLCQFEHN
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgaagggctgctggttgtcgtatccggtccgtcaggagccggaaagggcacg
cttttgaatttgctgaaggattccggagacgacaacataaggttttcggtttctgccacc
acaagagcaccgagagtgggcgaggtggatggcgtaaactatttttttaagaccaaagaa
gaatttatgcttatgattgaaaatgacgagctttttgaatgggtggagtactgtgacaac
ttttacggaactccgaagaagtacattgaggataccataaaaggtggctatgactgtttg
ctggaaatcgaagtggaaggagcggcaaaagtaatgaaagcctatcctgaatgtgtttcg
gtttttattttgccgccttcttttgaagagttgagaagaagaattgaaaaaagaggcact
gaggatgttgaggtggtgaataagcgccttgagagggcaaaaaaagaaattgcctatgct
tcaaactacgattacatcatagttaacgacaatcttaaagatgcagtggaaggtttgcgc
agcataatcaaggcagaaaagctgaagctcaagcgaaacagggatgtgctttgtcagttt
gaacacaactga

DBGET integrated database retrieval system