KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0997Help
Entry
Clo1313_0997      CDS       T01933                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_0997
   01230 Biosynthesis of amino acids
    Clo1313_0997
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0997
   00030 Pentose phosphate pathway
    Clo1313_0997
   00051 Fructose and mannose metabolism
    Clo1313_0997
   00052 Galactose metabolism
    Clo1313_0997
  Energy metabolism
   00680 Methane metabolism
    Clo1313_0997
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clo1313_0997
Protein phosphatases and associated proteins [BR:ctx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clo1313_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164394..1165368
Genome map
AA seq 324 aa AA seqDB search
MSSVRTIGVLTSGGDAPGMNAAIRSVVRTGLYYGFKVLGIRKGFNGLINGDIEELTARSV
GDIIHRGGTILQTARSPQFKTEEGLKKAMSMAKVFGIDALVVIGGDGSYRGARDISKLGL
NVIGIPGTIDNDIGCTDYTIGFDTAMNTVQDAIDKIRDTAYSHERCSVLEVMGRHAGYIA
VNVSISGGAEAVVLPEKPFDMDTDVIKPIIEGRNRGKKHYLVIVAEGGEGKAIEIAKEIT
EKTGIEARATILGHIQRGGSPTVYDRVMASQMGAKAVEVLMENKRNRVIVFKDNQIGDMD
LEEALQVKKTISEDLIQLSKILAL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgtaagaacgattggagttttgacaagcggtggagacgctcccggaatgaat
gcggccataaggtcggttgtgagaacaggactgtattatggctttaaggttttgggaata
agaaagggttttaacggtcttataaacggagatattgaagaactgacggcaagatcagtg
ggagatataattcacaggggaggtaccattctccagacagccagatcaccccagtttaag
accgaggaaggacttaaaaaagccatgtccatggcaaaagtatttggtattgacgctctt
gtggtaataggcggtgacggttcttacagaggagcaagagacatcagcaaacttggactt
aatgtcataggaatacccgggacgattgataatgacattggttgcaccgattataccata
ggttttgataccgccatgaacactgtccaggatgcgatagacaagatacgcgatactgca
tattcccatgaaagatgcagtgtgctggaagttatgggaagacatgccggatatattgct
gtgaatgtaagtatttccggaggtgctgaggctgtcgttctgcctgagaaaccttttgat
atggataccgatgtcataaagcccataattgagggaaggaacagaggcaaaaagcactac
cttgttatagttgccgaagggggagaaggcaaagccatcgagatcgcgaaagagattacg
gaaaagacgggtattgaagccagagccaccatactgggtcatatacaaaggggaggcagt
cccactgtatacgacagagtaatggcaagtcagatgggagcgaaggctgttgaagttttg
atggaaaacaagcgtaacagagtaattgtctttaaggacaaccagataggtgatatggat
ttggaagaagctttgcaggttaaaaagaccatttcggaagatttgattcagcttagcaaa
atattagcattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system