KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_1245Help
Entry
Clo1313_1245      CDS       T01933                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1313_1245
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clo1313_1245
Enzymes [BR:ctx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Clo1313_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1476355..1476729
Genome map
AA seq 124 aa AA seqDB search
MSKLIVTGGRKLKGEIVVEGSKNAVLPILAATVLNDGISVIKNCPKLRDVEIMLEILRKL
GCKVKFEEDVVTIDSSTINSTEIPEDLATEMRSSIIFLGPLLSRFKKVTISYPGGCESLL
AHFN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagctaattgtaacaggaggccggaagctaaagggcgaaatagttgtagaaggg
tcaaaaaatgctgttttacccattcttgccgccacggttcttaatgatggtataagtgtc
ataaagaattgtccaaagcttagagatgtggaaataatgcttgagattttaaggaaatta
ggttgcaaggttaagtttgaagaagatgttgttacgattgattcttcaacgattaacagc
accgaaattcctgaagatctcgcaacggaaatgagatcttctattatttttttaggtccc
ctgttgtccagatttaaaaaagtgactattagctacccgggtgggtgtgaaagtttattg
gcacattttaattaa

DBGET integrated database retrieval system