KEGG   Clostridium thermocellum DSM 1313: Clo1313_1347Help
Entry
Clo1313_1347      CDS       T01933                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctx01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ctx00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1593608..1594390
Genome map
AA seq 260 aa AA seqDB search
MILDEIVAQKKIQLKKDMSRITIEGWKQKIKRPGIHKPLDFYGALKNNGDISIIAEVKKA
SPSKGIIKEDFDPLKIAKEYVESDIQAISVLTERNFFKGDEDYLVKIRQFCPLPILRKDF
IIDLWQIYESRYIGADAILLIVSLLSDEELKKFQIVANILGMQCLVEVHDERELERALES
GARIIGINNRDLRTFEVDLKNTEKLMNRIPNDRVVVSESGIKDTEDLKYLKELGVDAVLI
GETFMRARSISEKIREFKAV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaaattgtagcgcaaaaaaaaatacagcttaaaaaagatatgagcagg
attaccatagaaggctggaagcaaaaaattaaaagaccgggaatccacaaacctctggac
ttttacggagctttaaagaacaatggggatatatccattattgccgaggtaaagaaggct
tcaccgtcaaaagggattataaaggaggactttgatccgctcaaaattgcaaaagaatac
gttgagtcggatattcaggctatatcggtgcttacggaaaggaactttttcaagggggat
gaagactaccttgtaaagattcgtcagttctgtcctcttcctattttgagaaaggatttt
ataatcgatttgtggcagatatatgagtcgcggtatattggggccgatgcaatattgctt
attgtatcactgctttccgatgaggaactgaaaaaattccagatcgttgcaaatatttta
gggatgcagtgcctggttgaggtgcatgatgaaagggaacttgagcgggctttggaatcc
ggcgcaagaataatcggaataaacaacagggatcttagaacttttgaagtggatttaaag
aatactgaaaagcttatgaacaggatacccaatgaccgggtggtggtaagcgaaagtgga
attaaggacaccgaagatttaaagtatctgaaagagcttggcgtggatgctgttttaatt
ggcgagacctttatgcgggcccggtccataagtgaaaaaataagagagtttaaagcggtg
tga

DBGET integrated database retrieval system