KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_1396Help
Entry
Clo1313_1396      CDS       T01933                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clo1313_1396
Enzymes [BR:ctx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clo1313_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1634731..1636680
Genome map
AA seq 649 aa AA seqDB search
MSRMTLKSSMKKRILSLVIAVVFLSLTGVFPSGLIETKVSAAKITENYQFDSRIRLNSIG
FIPNHSKKATIAANCSTFYVVKEDGTIVYTGTATSMFDNDTKETVYIADFSSVNEEGTYY
LAVPGVGKSVNFKIAMNVYEDAFKTAMLGMYLLRCGTSVSATYNGIHYSHGPCHTNDAYL
DYINGQHTKKDSTKGWHDAGDYNKYVVNAGITVGSMFLAWEHFKDQLEPVALEIPEKNNS
IPDFLDELKYEIDWILTMQYPDGSGRVAHKVSTRNFGGFIMPENEHDERFFVPWSSAATA
DFVAMTAMAARIFRPYDPQYAEKCINAAKVSYEFLKNNPANVFANQSGFSTGEYATVSDA
DDRLWAAAEMWETLGDEEYLRDFENRAAQFSKKIEADFDWDNVANLGMFTYLLSERPGKN
PALVQSIKDSLLSTADSIVRTSQNHGYGRTLGTTYYWGCNGTVVRQTMILQVANKISPNN
DYVNAALDAISHVFGRNYYNRSYVTGLGINPPMNPHDRRSGADGIWEPWPGYLVGGGWPG
PKDWVDIQDSYQTNEIAINWNAALIYALAGFVNYNSAQNEVLYGDVNDDGKVNSTDLTLL
KRYVLKAVSTLPSSKAEKNADVNRDGRVNSSDVTILSRYLIRVIEKLPI
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaatgaccttgaaaagcagcatgaaaaaacgtattttatctttggtcattgct
gtagtgtttctaagcttgaccggagtgtttccttcgggattgattgagaccaaagtgtca
gctgcaaaaataacggagaattatcaatttgattcacgaatccgtttaaactcaataggt
tttataccgaaccacagcaaaaaggcgactatagctgcaaattgttcaaccttttatgtt
gttaaagaagacggaacaatagtgtataccggaacggcaacttcaatgtttgacaatgat
acaaaagaaactgtttatattgctgatttttcatccgttaatgaagaaggaacgtactat
cttgccgtgccgggagtaggaaaaagcgtaaactttaaaattgcaatgaatgtatatgag
gatgcttttaaaacagcaatgctgggaatgtatttgctgcgctgcggcaccagtgtgtcg
gccacatacaacggaatacactattcccatggaccgtgccatactaatgatgcatatctt
gattatataaacggacagcatactaaaaaagacagtacaaaaggctggcatgatgcgggc
gactacaacaaatatgtggtaaacgccggcataaccgttggttcaatgttcctggcgtgg
gagcattttaaagaccagttggagcctgtggcattggagattcccgaaaagaacaattca
ataccggattttcttgatgaattaaaatatgagatagactggattcttaccatgcaatac
cctgacgggagcggaagggtggctcataaagtttcgacaaggaactttggcggctttatc
atgcctgagaacgaacacgacgaaagatttttcgtgccctggagcagtgccgcaacggca
gactttgttgccatgacggccatggctgcaagaatattcaggccttatgatcctcaatat
gctgaaaaatgtataaatgcggcaaaagtaagctatgagtttttgaagaacaatcctgcg
aatgtttttgcaaaccagagtggattctcaacaggagaatatgccactgtcagtgatgca
gatgacagattgtgggcggcggctgaaatgtgggagaccctgggagatgaagaatacctt
agagattttgaaaacagggcggcgcaattctcgaaaaaaatagaagccgattttgactgg
gataatgttgcaaacttaggtatgtttacatatcttttgtcagaaagaccgggcaagaat
cctgctttggtgcagtcaataaaggatagtctcctttccactgcggattcaattgtgagg
accagccaaaaccatggctatggcagaacccttggtacaacatattactggggatgcaac
ggcacggttgtaagacagactatgatacttcaggttgcgaacaagatttcacccaacaat
gattatgtaaatgctgctctcgatgcgatttcacatgtatttggaagaaactattacaac
aggtcttatgtaacaggccttggtataaatcctcctatgaatcctcatgacagacgttca
ggggctgacggaatatgggagccgtggcccggttaccttgtaggaggaggatggcccgga
ccgaaggattgggtggatattcaggacagttatcagaccaatgaaattgctataaactgg
aatgcggcattgatttatgcccttgccggatttgtcaactataattctgctcaaaatgaa
gtactgtacggagatgtgaatgatgacggaaaagtaaactccactgacttgactttgtta
aaaagatatgttcttaaagccgtctcaactctgccttcttccaaagctgaaaagaacgca
gatgtaaatcgtgacggaagagttaattccagtgatgtcacaatactttcaagatatttg
ataagggtaatcgagaaattaccaatataa

DBGET integrated database retrieval system