KEGG   Clostridium thermocellum DSM 1313: Clo1313_1620Help
Entry
Clo1313_1620      CDS       T01933                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1891844..1892821)
Genome map
AA seq 325 aa AA seqDB search
MFDLLKKFTGIVGVSGNEEEIREAIIEEIKECVDEIKVDTLGNLIAVKKGKGKKIMVAAH
MDEIGVMVTYIDDKGFLRFSAVGGVSRYDCIGQRVKFKNGVVGAVYYEEKLEDMKNLQLS
KMYIDIGARSREEALKMVNIGDVACFVGDAVLQGDTVISKALDNRSGCAVVVKAIKELKK
TDNEIYFVFTVQEEVGLRGAKTAAFSIKPDIAIAVDVTMTGDTPESHPMEVKCGGGPAIK
VKDRSVICHPEVRKLLEESAKRNNIPYQLEILEAGGSDPGSIHLTAGGIPSGAISIPVRY
VHSPVETASMSDINNAVKLLVEAIC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacttgctcaaaaagtttacaggaatcgttggagtatccggaaacgaagaagaa
ataagggaagctataattgaggaaattaaagaatgtgttgacgaaataaaagttgatact
ttgggaaaccttattgccgtcaaaaaaggcaagggcaaaaaaatcatggtggcggctcat
atggatgagattggcgtaatggttacatatatagacgacaagggctttttaaggttttct
gccgtcggaggggtcagccgctatgactgtataggccagagggtgaagtttaaaaacgga
gttgtcggagctgtttattacgaggaaaaacttgaggatatgaagaatctccagctttcc
aaaatgtatatagatattggagcaagaagcagagaggaagccctgaagatggtaaatatc
ggagatgtcgcctgctttgtcggagatgcggtgcttcagggggataccgtgatatcgaag
gcattggacaacagaagcggctgtgcggtggttgtaaaggcgataaaagagttgaaaaag
acggataatgaaatatattttgtgtttacggttcaggaagaggtcggtttgagaggagca
aaaaccgcggctttcagtataaagcctgatatagccatagctgtggatgttacaatgacg
ggagacacaccggaatcgcatcctatggaggttaagtgcggcggcgggcctgcaattaaa
gtaaaggatcgttccgtcatttgtcatccggaggtaagaaaacttttggaagagtcagca
aaaaggaataatattccttatcagttggaaatacttgaagcaggagggagcgacccgggc
tcaatacatttgacggcgggaggaataccttcgggtgcgatatccataccggtgaggtat
gttcacagtccggtagagaccgccagcatgtcggatattaataatgccgtaaaattgttg
gttgaagccatttgctga

DBGET integrated database retrieval system