KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_1681Help
Entry
Clo1313_1681      CDS       T01933                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Clo1313_1681
Enzymes [BR:ctx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Clo1313_1681
Peptidases [BR:ctx01002]
 Cysteine Peptidases
  Family C44
   Clo1313_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1966330..1968171
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWINLKSDLTNQKEILNSMIDRLTPRGPDASGSWISPNALIAHKRLIVVDPEGGI
QPMVRRQGENTYVITYNGELYNTADLRNELESRGHEFLTSSDTEVLLVSYIEWGAKCVEH
LNGIYAFGIWDEGKKRLFLGRDRFGVKPLFYAQRGDSLIFGSELKALLANPLVEPKLDAE
GLAEIFALGPARTPGHGIFKDVYELKPAHSMIFDINGIQIRKYWSLESYPHTDSEKATIS
KVRDLVLDAITRQLVADVPVCTFLSGGLDSSAITAVASKTFASQGKGQLNTFSVDYVDND
IYFKPSMFQPNSDEPWIKKMSESFNTCHHYVKFDTPQLVDALIDAVKARDLPGMADIDSS
LFLFCREVKKFSVVALSGECADEIFGGYPWFHNEKMLFADTFPWSVSVHERTKILSPEIL
NLIKPEEYIQRRYRETLSEVPHLKGENRIEARRREIFYLNINWFMATLLDRKDRMSMASG
LEVRVPFCDHRLVQYVWNIPWELKMYNKREKGLLRQALKGILPDDIIERKKSPYPKTHNP
SYKKAVSKWLLEILNDSSSPLHQLIDVKVVRSMAEGNSDNTDPWFGQLMAQPQMLAYLIQ
VDFWLRDNHISIV
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgcaggatggataaatcttaaatcagacttgaccaatcaaaaagaaata
ttaaattcaatgattgacaggctgacccccaggggacccgatgcatcgggaagttggatt
tctccaaatgcgcttattgcccataagcgtttgatagttgtcgacccggaaggcggaatt
caacccatggttcgcaggcagggtgaaaacacgtacgttattacatacaacggggaactt
tacaacactgcggacctgcgaaacgaacttgaatccaggggccatgaatttttaacaagc
tctgacacggaagttttacttgtttcctatattgaatggggtgcaaaatgtgtcgaacat
ctaaacggaatatatgctttcggaatttgggatgaaggaaaaaagaggctttttctggga
agggacagattcggcgtaaaacccctgttttatgcccaaagaggagattctttgatattt
ggctctgaattaaaggcgctcctggcaaatccccttgtggagccaaaattggatgccgaa
ggcttagcggaaatctttgcgctgggacccgcccgaacaccgggacacggtatattcaaa
gatgtttatgaactaaaacccgctcactcaatgatttttgatataaacggaatacagatc
agaaaatactggtcgctggaaagttatccccataccgacagtgaaaaagccaccatatcc
aaagtcagagatttggtattggatgccatcacaaggcaacttgtggcagatgttcctgtc
tgtacttttctgtcgggcggacttgattcaagtgccattacggctgttgcttcaaagact
tttgcctcccagggcaaaggacagcttaacactttttctgtagattatgtagacaatgac
atttattttaagcccagcatgtttcagccaaactccgatgaaccctggataaaaaaaatg
agtgaaagctttaatacatgccatcactatgtaaaatttgacacaccacagctggttgac
gctcttattgacgctgtaaaggcacgggacctgccgggaatggcagatattgactcatcc
ctgtttcttttctgccgggaggtgaaaaaattttcggttgtggcattatccggtgaatgt
gcggatgaaatattcggaggatatccgtggtttcataatgagaaaatgctgtttgccgat
actttcccctggtccgtttcggtacacgaaaggacaaaaatactgtcccctgagattttg
aatttgataaagcctgaagaatacatccaaagacgttatagagaaactctaagcgaggtt
ccgcacttaaaaggggaaaacagaattgaagccagaagaagagaaatcttttacctaaac
atcaactggttcatggccaccttgcttgacagaaaagaccgcatgagtatggcatcgggt
cttgaagtaagggttccgttctgcgaccacagactggtccaatacgtatggaacatacca
tgggagttgaaaatgtacaacaaaagagaaaaagggcttttaagacaggctctaaaaggc
atacttccagatgatataattgagagaaagaaaagcccatacccgaaaactcataatcct
tcatataaaaaagctgtcagcaaatggctgctcgaaatattaaacgacagcagttcacct
cttcatcaattaattgacgtaaaagtggtaaggtccatggccgaaggaaattcggacaac
acagatccctggttcggccagttgatggcacagccccaaatgcttgcctatcttatccag
gtggatttttggctgcgggataaccatatatcaattgtataa

DBGET integrated database retrieval system