KEGG   Clostridium thermocellum DSM 1313: Clo1313_1686Help
Entry
Clo1313_1686      CDS       T01933                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ctx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ctx00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ctx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975267..1976931
Genome map
AA seq 554 aa AA seqDB search
MLEKYLSKVNFNSYDDFVQNFKLNIPENFNFAYDVADEIADKTPEKVALVWCNDRGEEAT
FTFGQLKEYSNKAANFFKRVGIKKGDRVMLILKRRYEFWFAILALHKIGAACIPATHLLT
AKDIIYRNNAADIKMIVCVGEDEVIKHVEESLEQSPTVMAKALIGRDKEGWYNFNKEIEN
ESSHFERPTGKDATTNDDIMLLYFTSGTTGMPKMVAHDFTYPLGHIVTAKYWQNVIDGGL
HLTVADTGWAKAAWGKIYGQWIAGSAVFVYDYDNKFVPKDLLDVICKYGVTTFCAPPTIY
RFFIKEDLTKYDFSKLKYCTVAGEPLNPEVYNQFYKATGIKLMEGYGQTELTLTIGTFPW
MEPKPGSMGKPSAGYVIDILDENGNPCEVGEEGQIVIRTDKSKPIGMFDGYYRDTELTKK
VWHDDIYYTGDMAWRDEDGYFWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITA
VPDPIRGQVVKATVVLAKNYSPCDELVKELQEHVKKVTAPYKYPRIIEFVDELPKTISGK
IRRVEIRNKDQAKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaaatatttgtcaaaagtaaattttaattcatatgacgattttgttcaaaat
tttaaattgaacattcctgaaaatttcaattttgcttatgatgttgccgacgaaattgca
gacaaaactcctgaaaaagtggcattagtctggtgtaatgataggggcgaggaagcaaca
tttactttcggccaattaaaagagtacagcaacaaagccgcaaatttctttaagagagtg
ggaataaaaaaaggcgaccgtgtaatgcttattttaaaaaggcgttacgaattctggttt
gcaattctcgctcttcacaagataggcgcggcatgcataccggccactcatcttcttacc
gcaaaagacataatttacagaaacaatgcggctgacatcaaaatgattgtatgtgttggc
gaagacgaagtaataaaacacgttgaagaatcactggagcaatcacccactgttatggca
aaagctcttatcggcagagacaaggaaggctggtacaactttaacaaagaaatcgaaaac
gaatcttcacattttgaaagaccaacaggcaaagatgcaacaactaatgacgatatcatg
cttttgtactttacttcaggaaccaccggaatgccaaaaatggtggcccatgactttact
tatcctttgggccatattgtaaccgccaaatactggcagaatgtaattgacggcggactg
caccttaccgttgcggacactggatgggcaaaagccgcctggggtaaaatctacggtcaa
tggattgccggaagtgctgtttttgtatacgactatgataacaaatttgttccaaaggat
cttctcgatgtaatatgcaagtatggtgttactactttctgtgcacctcctacaatttac
aggttctttataaaagaggacttaaccaaatatgatttcagcaagctgaaatattgtacc
gttgcaggtgaaccactgaatcctgaagtatacaaccagttttacaaagcaacgggcatc
aagcttatggaaggatatggtcagacagagcttactttgaccataggtacattcccctgg
atggaacccaagccaggttcaatgggcaagccgtctgcaggctatgtcatagatattctt
gacgaaaatggcaatccttgcgaagtcggtgaggaaggccagatagttataagaacggat
aaaagcaaacctataggaatgtttgacggatattacagggatactgagcttacaaaaaag
gtatggcacgatgatatctattataccggagacatggcttggcgcgatgaggatggttat
ttctggtttgtcggcagggctgatgacgttataaagagctccggatacagaatcgggcct
tttgaagtagaaagcgcccttttggagcatcccgcggttttggaatgcgcaataacagct
gtcccggatcctatcagaggtcaggtggttaaagccactgtcgttcttgccaaaaattat
tctccttgcgatgaacttgtaaaggaacttcaggagcatgtcaagaaagtaaccgcacct
tacaagtaccccagaattatcgagtttgttgatgagcttccaaaaaccataagcggaaaa
atcagaagagtggaaatcagaaacaaggaccaggcaaaaaaataa

DBGET integrated database retrieval system