KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_1876Help
Entry
Clo1313_1876      CDS       T01933                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_1876
   01230 Biosynthesis of amino acids
    Clo1313_1876
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_1876
   00030 Pentose phosphate pathway
    Clo1313_1876
   00051 Fructose and mannose metabolism
    Clo1313_1876
   00052 Galactose metabolism
    Clo1313_1876
  Energy metabolism
   00680 Methane metabolism
    Clo1313_1876
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Clo1313_1876
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clo1313_1876
Protein phosphatases and associated proteins [BR:ctx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clo1313_1876
Messenger RNA biogenesis [BR:ctx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Clo1313_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193153..2194400
Genome map
AA seq 415 aa AA seqDB search
MSRLEGACIFGQSGGPTSVINASAAGVIQEALKQDCITAVYGAAHGIKGILEENFFDMSK
EDPYELELLKTTPSSALGSVRYKLKDADEDETDYKRLLEVFKKYNIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRVMGVPKTIDNDLWGTDHCPGYGSAAKYIATSIMEVYHDARVYDT
GMITILEIMGRNAGWLTAAAALASYKGNGPDLIYLPELSFDIDKFVEDVTRIYKENGKVI
VAVSEGIKDKNGKYISEYGSDLAKTKDSFGHAQLGGLASTLANIVKEKTGAKVRGIEFSL
LQRCAAHVASLTDVNEAYLAGQAAVQYAVEGKTDYMVAFERAEGPEYKCNIKLLNLSEVA
NTEKKVPLEWIKPDGAGLTEDFIKYALPLIQGESRPPIEDGLPRFAKLKKVLARK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtttagaaggtgcatgcatattcggacaatccggcggtccgacatcagttatc
aacgcaagtgcggctggtgttattcaggaagctttaaagcaggattgtatcacagcagtt
tacggagcagctcatggaatcaagggtattttggaagaaaacttctttgacatgagtaag
gaagatccttatgaattggaacttttaaaaactaccccttcatctgctctgggttctgta
agatacaaactcaaagacgcagacgaggatgaaacggattacaagagacttttggaagta
ttcaagaaatacaatatcagatacttcttctacaatggcggaaacgactcaatggacacc
tgcaacaaggtcagcaaatacatgcagaaggttggctatgagtgcagagtaatgggtgtg
ccgaagacaatagacaacgacctttggggaacagaccactgccccggttacggaagtgcc
gcaaaatatatagcaacatccattatggaagtttatcatgatgcaagagtttacgataca
ggaatgataacaattctcgaaatcatgggaagaaacgcaggctggcttaccgctgccgca
gctttggcttcatacaagggcaatggtcctgatttgatataccttcccgagctttccttt
gacatagacaaatttgttgaagatgtgacaagaatctacaaagaaaacggaaaggttatt
gtagccgtatctgaaggtatcaaagacaaaaacggaaaatatatttccgaatacggttca
gaccttgcgaaaacaaaagactcctttggacatgcacagttgggcggtcttgcttcaaca
ctggctaacattgttaaagagaagaccggcgcaaaggttcgcggcattgaattcagcctt
ctccaaagatgcgcagctcacgtagcttctcttaccgacgtaaatgaagcttatcttgca
ggacaggcagccgtacaatatgccgttgaagggaaaacagactacatggttgcttttgaa
agagcggaaggtcctgaatacaagtgcaatatcaagcttctgaacctcagtgaagttgca
aatactgagaagaaagttccgttggaatggattaaacctgacggagcaggccttacagaa
gactttattaagtatgctcttccgttaattcagggagaatcaagacctcctatcgaagat
ggtcttccaagatttgcaaaactgaaaaaggttcttgcaagaaaataa

DBGET integrated database retrieval system