KEGG   Clostridium thermocellum DSM 1313: Clo1313_1876Help
Entry
Clo1313_1876      CDS       T01933                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ctx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctx00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ctx00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ctx00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ctx00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ctx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193153..2194400
Genome map
AA seq 415 aa AA seqDB search
MSRLEGACIFGQSGGPTSVINASAAGVIQEALKQDCITAVYGAAHGIKGILEENFFDMSK
EDPYELELLKTTPSSALGSVRYKLKDADEDETDYKRLLEVFKKYNIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRVMGVPKTIDNDLWGTDHCPGYGSAAKYIATSIMEVYHDARVYDT
GMITILEIMGRNAGWLTAAAALASYKGNGPDLIYLPELSFDIDKFVEDVTRIYKENGKVI
VAVSEGIKDKNGKYISEYGSDLAKTKDSFGHAQLGGLASTLANIVKEKTGAKVRGIEFSL
LQRCAAHVASLTDVNEAYLAGQAAVQYAVEGKTDYMVAFERAEGPEYKCNIKLLNLSEVA
NTEKKVPLEWIKPDGAGLTEDFIKYALPLIQGESRPPIEDGLPRFAKLKKVLARK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtttagaaggtgcatgcatattcggacaatccggcggtccgacatcagttatc
aacgcaagtgcggctggtgttattcaggaagctttaaagcaggattgtatcacagcagtt
tacggagcagctcatggaatcaagggtattttggaagaaaacttctttgacatgagtaag
gaagatccttatgaattggaacttttaaaaactaccccttcatctgctctgggttctgta
agatacaaactcaaagacgcagacgaggatgaaacggattacaagagacttttggaagta
ttcaagaaatacaatatcagatacttcttctacaatggcggaaacgactcaatggacacc
tgcaacaaggtcagcaaatacatgcagaaggttggctatgagtgcagagtaatgggtgtg
ccgaagacaatagacaacgacctttggggaacagaccactgccccggttacggaagtgcc
gcaaaatatatagcaacatccattatggaagtttatcatgatgcaagagtttacgataca
ggaatgataacaattctcgaaatcatgggaagaaacgcaggctggcttaccgctgccgca
gctttggcttcatacaagggcaatggtcctgatttgatataccttcccgagctttccttt
gacatagacaaatttgttgaagatgtgacaagaatctacaaagaaaacggaaaggttatt
gtagccgtatctgaaggtatcaaagacaaaaacggaaaatatatttccgaatacggttca
gaccttgcgaaaacaaaagactcctttggacatgcacagttgggcggtcttgcttcaaca
ctggctaacattgttaaagagaagaccggcgcaaaggttcgcggcattgaattcagcctt
ctccaaagatgcgcagctcacgtagcttctcttaccgacgtaaatgaagcttatcttgca
ggacaggcagccgtacaatatgccgttgaagggaaaacagactacatggttgcttttgaa
agagcggaaggtcctgaatacaagtgcaatatcaagcttctgaacctcagtgaagttgca
aatactgagaagaaagttccgttggaatggattaaacctgacggagcaggccttacagaa
gactttattaagtatgctcttccgttaattcagggagaatcaagacctcctatcgaagat
ggtcttccaagatttgcaaaactgaaaaaggttcttgcaagaaaataa

DBGET integrated database retrieval system