KEGG   Clostridium thermocellum DSM 1313: Clo1313_1907Help
Entry
Clo1313_1907      CDS       T01933                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clo1313_1907
Enzymes [BR:ctx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Clo1313_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2228047..2228691)
Genome map
AA seq 214 aa AA seqDB search
MSDAIREQIVKVAKLMYEKGMVNAFAGNLSVRDGNNVYITPSGICKGFLKEDMIVKTDMN
GNILEGMYKPSSEIKLHLEAYKKRKDIYSVVHAHPPYTTAYAVANKPIESKACAEMVIFF
GKIPLAAYGTPSTDEIFSGVEEYINEYDVILLANHGIVSFGRDVFDAYFKLEAAEDIAKT
LILSRLLGGEKDLPENKLKELDDMRKKRRTEVYW
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgctattagagaacaaatagtgaaagtagcaaagttaatgtatgagaaaggt
atggtaaacgcttttgccggaaacctttccgttcgggacggcaacaatgtttacattaca
cccagcggtatatgcaaaggttttttaaaggaagacatgattgtgaaaactgatatgaac
ggaaatatactggaagggatgtacaagccttcgtctgaaataaaacttcatctcgaggca
tacaagaaaaggaaggatatatattccgtggtgcatgcccatcctccttataccactgcg
tacgcggttgccaacaaacctattgaatcaaaagcgtgtgctgaaatggttatttttttt
ggaaagatacctcttgcagcatacggtaccccgtcgacagatgaaatatttagcggtgtc
gaagaatatattaatgagtacgatgttatccttcttgccaatcacggaatagtgtctttt
ggaagagatgtctttgatgcctactttaagcttgaagcggctgaggatatagctaaaact
ttgattttatcgcgccttctcgggggagagaaagacttgccggagaacaaactaaaggag
cttgatgacatgagaaaaaaacgtagaacggaagtttactggtaa

DBGET integrated database retrieval system